KEGG   Acidiphilium cryptum: Acry_0529Help
Entry
Acry_0529         CDS       T00527                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acr  Acidiphilium cryptum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acry_0529
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Acry_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
589890..590306
Genome map
AA seq 138 aa AA seqDB search
MQKIETIHLEAVSSWYRTRPVPPDPTQPDFCNGVVRFSGAPDPVALLEALHEIEARFGRV
RSVPNAARTLDLDLIDVNGMVRETGSPILPHPRAHLRTFVLRPLLDVAPDWVHPLLLRPA
RELFSALPERAEGEIRLW
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaattgagacaattcaccttgaggctgtctcatcctggtatcgcacgcgcccg
gttccgcctgatccgacgcaaccggatttctgcaatggtgtcgtccggttttcgggagcg
cctgatcccgttgcgctgctcgaggcactgcacgagatcgaggctcggtttggccgcgtc
cggtcggttccgaatgcggcacgcacgctggatctcgacctgatcgacgtgaacgggatg
gtgcgggagaccgggtcgccgatcctgccgcatccgcgcgctcatctgcggacattcgtg
ctccggccgctgcttgatgtcgcgcctgattgggtgcatcctctgctgctacgtccggca
agggaattgttctccgcgctgccggaacgtgcggaaggcgaaatccgcctctggtag

DBGET integrated database retrieval system