KEGG   Acidiphilium cryptum: Acry_0570Help
Entry
Acry_0570         CDS       T00527                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
acr  Acidiphilium cryptum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(641181..642311)
Genome map
AA seq 376 aa AA seqDB search
MTDMARRNFLGLLGAAALTGGPVMMARELWQSSWRGYRHGFIDGQGRVIDYSANKGFSTS
EGQSYGMFLSLVAGDRATFRRILNWTNTNMAGGRLGEVLAAWKWGLHGGKWGVIGANSAA
DADAWMAYSLLEAARIWKDHNLGAEGHKLATRIADDESVAINGFGRVLIPGASDFPDTPP
VIVDPSYTPLFLARGIARATNLPKWQAIAATLPRLMTTICRNGFAPDWAWAPQAPASPPA
GLPETGTGSFDAIRCYLWAGLTAPETEGSATVLASLKGMARYLATHRAPPQSVDLASQAT
HGTGGIGFSAALLPYLAALGRHRLLHQQLGRVLAQRETSGLFGQPADYYSENLILFGLGG
LSGSIRFDKQGGLITS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatggcgagacgcaattttctcggtcttctcggcgcggccgcgctcacgggc
ggcccggtgatgatggcgcgggagctgtggcaatcgtcctggcgcggctaccggcacgga
ttcatcgacggccaggggcgggtcatcgactattccgccaacaagggattcagcacttcg
gaggggcagtcctatggcatgttcctcagtctcgtcgccggcgaccgcgcgacgttccgc
cgcatcctgaactggacgaacacgaacatggcgggcgggcgcctcggggaggtgctcgcg
gcgtggaaatgggggctgcacggcggcaaatggggggtgatcggcgccaactcggcggcg
gacgcggatgcgtggatggcctattcgctgctcgaggccgcccggatctggaaggatcac
aatctcggcgccgaggggcacaagctggcgacgcgcatcgccgatgacgagagcgtggcg
atcaacggatttggccgggtcctgatacccggcgcctccgattttccggacacgccgccc
gtcatcgtcgatccgagctatacgccgctgtttctggcccgcggcatcgcgcgcgcgacc
aacctgccgaaatggcaggcgatcgcggccacgctgccacggctgatgacgacgatctgc
cgcaacggattcgcccccgactgggcctgggcgccgcaagcccccgcctcgccgccggcg
ggcctgccggagaccggcaccggatcgttcgatgcgatccggtgctatctctgggcgggc
ctgaccgcgccggaaacggaggggagcgcgaccgttctcgcctcgctgaagggcatggcc
cgatacttggccacccaccgcgcgccgccgcagagcgtcgatctcgcgagccaggcgacg
cacgggacgggcgggatcgggttttccgcggcgctgctgccctacctcgcggcactcggg
cgccaccggctgctccatcagcagctcggccgcgtgctggcccagcgggagaccagcggc
ctgttcggccagcccgccgactattactcggaaaacctgatcctgttcggacttggcgga
ctttcgggaagcatccgcttcgacaagcaaggaggtctgatcacgtcatga

DBGET integrated database retrieval system