KEGG   Acidiphilium cryptum: Acry_0624Help
Entry
Acry_0624         CDS       T00527                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
acr  Acidiphilium cryptum
Pathway
acr00071  Fatty acid degradation
acr00280  Valine, leucine and isoleucine degradation
acr00281  Geraniol degradation
acr00310  Lysine degradation
acr00360  Phenylalanine metabolism
acr00362  Benzoate degradation
acr00380  Tryptophan metabolism
acr00410  beta-Alanine metabolism
acr00627  Aminobenzoate degradation
acr00640  Propanoate metabolism
acr00650  Butanoate metabolism
acr00903  Limonene and pinene degradation
acr00930  Caprolactam degradation
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01212  Fatty acid metabolism
Module
acr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acry_0624
   00650 Butanoate metabolism
    Acry_0624
  Lipid metabolism
   00071 Fatty acid degradation
    Acry_0624
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acry_0624
   00310 Lysine degradation
    Acry_0624
   00360 Phenylalanine metabolism
    Acry_0624
   00380 Tryptophan metabolism
    Acry_0624
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acry_0624
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Acry_0624
   00281 Geraniol degradation
    Acry_0624
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acry_0624
   00627 Aminobenzoate degradation
    Acry_0624
   00930 Caprolactam degradation
    Acry_0624
Enzymes [BR:acr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Acry_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABQ29846
UniProt: A5FW64
Position
703714..704811
Genome map
AA seq 365 aa AA seqDB search
MSGETTADVEIRIEGRVGRISLNRPRALNALTHDMEVAIDAALLRWADDPSVAFVMVDGR
GERGLCAGGDIRALYDAAKSGGERLAFPFFGDEYRMNAHIANYPKPFVALMDGIVMGGGV
GISAHGSHRIVTERTMLAMPEVGIGFVPDVGGTFLLGRMPGETGIHAALTAHRMTGADAV
SCGIADHYVESRHLPALTAALAALVDGADVDDCIAAFATPAPDSPLLAERAWIDDCYKAP
TAEAIVAALEAHAEPAAREAAATIRRMSPTSVKLSLRLVRAARGDAKVETAIDREFRVAV
RCVAAHDFVEGVRAQLVDKDRNPRWQPATLDGVDDEALDAYFAPLGADELGLDALEHFPI
LSDRM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggagacgaccgcggatgtcgagatccggatcgagggcagggtcggccggatc
agcctgaaccggccgcgggcgctgaacgcgctgacgcacgacatggaagtggcgatcgac
gcggcgctgctgcgctgggcggacgatccttccgtcgccttcgtgatggtggacgggcgc
ggcgagcgcgggctgtgcgcgggcggcgatatccgcgcgctgtacgacgcggcgaagagc
ggcggcgaacgcctggcgtttccattctttggcgacgaatacaggatgaacgcgcatatc
gcgaattatccgaagcccttcgtcgcgctgatggacgggatcgtgatgggcggcggcgtc
ggcatttcggcgcacgggtcgcaccgcatcgtcaccgagcggacgatgctggcgatgccg
gaggtcggcatcggcttcgtgccggatgtcggcggcactttcctgctcgggcggatgccg
ggcgagaccggcattcacgccgcactcaccgcgcaccggatgaccggcgccgatgcggtg
tcctgcggcatcgccgatcattacgtggaaagccggcatctgccggcgctgacggcggcg
ctggcggcgctggtggatggcgcggatgtcgatgactgcatcgccgccttcgcgacgccg
gcgccggactcgccgctgctcgccgagcgcgcctggatcgacgattgctacaaggcgccg
acggccgaggcgatcgtcgcggcgctggaggcgcatgccgaaccggcggcgcgcgaggcg
gcggcgacgatcaggcggatgtcgccgacctcggtgaagctcagcctgcgcctcgtgcgc
gcggcgcggggcgatgcgaaggtggagaccgcgatcgaccgcgagttccgcgtcgcggtg
cgctgcgtcgccgcgcatgatttcgtcgagggcgtgcgggcgcagctcgtcgacaaggac
cgcaatccgcgctggcagccggcgacgctcgatggcgtggatgatgaagcgctcgatgcc
tatttcgcgccgctcggcgccgatgagctggggctcgacgcactagagcactttccgatc
ctttcggatcggatgtag

DBGET integrated database retrieval system