KEGG   Acidiphilium cryptum: Acry_0733Help
Entry
Acry_0733         CDS       T00527                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acr  Acidiphilium cryptum
Pathway
acr00240  Pyrimidine metabolism
acr00250  Alanine, aspartate and glutamate metabolism
acr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acry_0733
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acry_0733
Enzymes [BR:acr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acry_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DeoC
Motif
Other DBs
NCBI-ProteinID: ABQ29953
UniProt: A5FWH1
Position
complement(820351..821286)
Genome map
AA seq 311 aa AA seqDB search
MRLPTRHLLGIEGLHPRDISALLDLAESYVLLNRSGKTRRDVLRGRTLINLFFEDSTRTR
TSFELAGKRLGADVINMSVSTSSVSKGETLLDTAATLNAMNCDLLVVRHKASGAPALLAQ
KVDAAVINAGDGMHEHPTQALLDALTIRRNKGTLAGLTVAICGDIAHSRVARSNLLLLTA
MGSRVRVVGPPTLIPSGIDQFGATVFHDMREGLRDADIVMALRLQTERMSAGLIPSAREF
FTFYGLDAAKLAMAKPDALVMHPGPMNRGVEIDSQVADDATRSVIREQVEMGVAIRMAVL
DVLARTALAHA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgccgacgcgccatctcctgggaatcgaaggtctccacccgcgcgacatttcc
gccctgctcgacctcgccgagagctacgtgctgctcaaccggtcgggcaagacgcggcgg
gacgtgctgcgcggccggaccctgatcaacctgttcttcgaggattccacccgcacccgc
acgagcttcgagctcgccggcaagcggctcggcgccgatgtgatcaacatgtcggtctcg
acctcctcggtctccaagggcgagaccctgctcgacaccgcggcgacgctgaacgcgatg
aactgcgacctgctggtggtccgccacaaggcctccggcgcgcccgccctgctcgcccag
aaggtggatgcggcggtgatcaacgccggcgacggcatgcacgagcacccgacccaggcg
ctgctcgacgcgctgacgatccgccgcaacaagggcacgctcgcgggcctcaccgtcgcc
atctgcggcgacatcgcgcattcccgcgtcgcccgctcgaacctgctgctgctcaccgcg
atgggcagccgggtgcgcgtggtcggcccgccgacgctgatcccctccggcatcgaccag
ttcggcgccaccgtcttccacgacatgcgcgagggcctgcgcgacgccgatatcgtgatg
gcgctgcggttgcagaccgagcggatgagcgccgggctgatccccagcgcgcgcgagttc
ttcaccttctacgggctcgacgccgccaagctcgcgatggcgaagccggacgcgctggtg
atgcatcccggcccgatgaatcgcggcgtcgagatcgacagccaggtcgccgacgacgcc
acccgctcggtgatccgcgagcaggtggagatgggcgtcgccatccgcatggcggtgctc
gacgtgctggcccggacggcgctcgcccatgcatga

DBGET integrated database retrieval system