KEGG   Acidiphilium cryptum JF-5: Acry_0816Help
Entry
Acry_0816         CDS       T00527                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
905717..906553
Genome map
AA seq 278 aa AA seqDB search
MTDVAASGWAGFDLARPLVMGILNATPDSFSGGGATQGPSALIETGLAMRAAGAAIIDVG
GESTRPGAAVVPPDIEIARIVPVIGGLARDGATVSVDTRNAATMRAALDAGARIVNDVSG
LRHDPAAAPLVAAAACPVILMHMRGTPATMSAQAVYDDVVADVLAELAATRDAALAAGIA
PAAIALDPGFGFAKRGAQNVALLRALPSFRALGHPVLAGVSRKRFIGELAGEPDPARRDP
GSIAAALFAAGRGAAILRVHDVPGTVQALRVWQALADA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtcgccgcatccggctgggcggggttcgacctcgcccggcccctcgtcatg
ggcatcctgaacgccacgcccgacagtttttcgggtggcggcgcgacgcaaggcccctcg
gccctgatcgaaaccgggctcgccatgcgcgcggccggcgccgcgatcatcgatgtcggc
ggcgaaagcacccgccccggcgccgccgtggtgccgcccgacatcgagatcgcccgcatc
gtgccggtcatcggcggcctcgcccgggacggcgcgaccgtctcggtcgacacgcggaac
gccgccaccatgcgcgccgccctcgatgccggggcgcgcatcgtcaacgacgtctccggc
ctccgccacgatcccgccgccgcgccgctggtcgccgccgccgcctgccccgtcatcctg
atgcacatgcgcggcaccccggcgacgatgagcgcgcaggcggtctatgacgatgtcgtc
gccgatgtcctcgccgaactcgccgccacccgcgacgccgcccttgccgccggcatcgcg
cccgccgccatcgcgctcgatcccggtttcggcttcgccaagcgcggcgcgcagaacgtg
gcgctgctgcgcgccctgccatccttccgcgcgctcggccatccggtcctcgccggcgtc
tcgcgcaagcgcttcatcggcgaactcgccggcgagcccgaccccgcccgccgcgatccc
ggctccatcgccgccgccctgttcgcggcggggcggggggcggcgatcctccgcgtccac
gacgtgcccggcacggtgcaggcgctgcgcgtctggcaggccctcgccgatgcctga

DBGET integrated database retrieval system