KEGG   Acidiphilium cryptum: Acry_0951Help
Entry
Acry_0951         CDS       T00527                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acr  Acidiphilium cryptum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acry_0951
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Acry_0951
Enzymes [BR:acr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acry_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1056923..1057849
Genome map
AA seq 308 aa AA seqDB search
MKAAILGIAGPTLAPEERALFAEHPPAGVILFGRNIADPAQLRDLVAALRESLPKEAVLM
VDQEGGRVARLRAPHWPELPPAAHLGALFATDPDAARNAARAHGAAIGAMARDAGFDVVA
APVLDVPVPGAHDVIGDRAIAADPAVVGALGADIAWGLMFQGIVPVMKHMPGHGRAGLDS
HHGLPRVTATALDADFAPFAANRDLPWGMTAHILYEALDPAHPATFSRRIIEEVIRGRIG
FRGILVSDDLAMGALDGTPASRALRALAAGCDLALYCPGEPAANRAVLEAVPDLDVALIP
RLKQTAIP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccatactcggcatcgccggccccaccctcgcgccggaggaacgtgcgctg
ttcgccgagcatccgccggcgggcgtgatcctgttcggccgcaacatcgccgacccggcg
cagctccgcgatctcgtcgccgcgctgcgcgagagcctgccgaaagaggcggtgctgatg
gtcgaccaggaaggcggccgcgtcgcccggctgcgcgcgccgcactggcccgaactgccg
cccgccgcccatctcggcgccttgttcgcgacggaccccgacgccgcccgcaacgccgcc
cgcgcccatggcgccgcgatcggcgcgatggcccgcgacgcggggttcgacgttgtcgcc
gccccggtgctcgacgtcccggttccgggtgcgcatgacgtgatcggcgaccgggcgatc
gccgccgaccccgccgtggtcggcgcgctgggggcggacatcgcctggggcctgatgttc
cagggcatcgtgccggtgatgaagcacatgcccggccacggccgcgccgggctcgacagc
catcacggcctgccacgcgtcaccgcaaccgcgctcgatgccgatttcgcgcccttcgcg
gcgaatcgcgacctgccctggggcatgaccgcgcatatcctctacgaggcgctcgacccc
gcccatcccgcgaccttctcgcgccggatcatcgaggaggtgatccgcgggcggatcggc
ttccggggcattctggtcagcgacgacctcgcgatgggcgcgctcgacggcacgccggcc
tcccgcgccctgcgcgcccttgccgccggctgcgacctcgccctctactgccccggagag
cctgcggccaaccgcgcggtgctcgaagccgtgcccgatctcgacgtagcgctgatcccc
cgcctcaagcagacggcgattccatga

DBGET integrated database retrieval system