KEGG   Acidiphilium cryptum: Acry_1022Help
Entry
Acry_1022         CDS       T00527                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acr  Acidiphilium cryptum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acry_1022
   00052 Galactose metabolism
    Acry_1022
   00500 Starch and sucrose metabolism
    Acry_1022
   00520 Amino sugar and nucleotide sugar metabolism
    Acry_1022
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acry_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1134640..1135518)
Genome map
AA seq 292 aa AA seqDB search
MPIKPLKKAVLPVAGLGTRFLPATKAIPKEMLPVVDKPLIQYAIDEARAAGIEQFCMVTG
RGKTALIDHFDIAFELEATLAERGKQDALDMLHEEVMEPGSIVTVRQQVPLGLGHAIWCA
RAFIGDDPFAILLPDDLVLSQTPCLGQLADAYRATGGNVVAVEEVPMEQVHRYGVLKTGA
TERNLVEVKGLVEKPKREEAPSNLSIIGRYVLLPEVIGHLARMERGAGNEVQLTDAMAKM
IGAAPFHGLKFEGRRFDCGDKAGYLEAQIAFGLVRPDLGPSIRHFLKAYSDA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatcaaaccattgaaaaaagccgttcttcccgttgccggcctggggacgagattc
ctcccggccaccaaggcgattcccaaggagatgttgcccgtcgtcgacaagccgctgatc
cagtacgcgatcgacgaggcgcgggcggccgggatcgagcagttctgcatggtcaccggg
cgcggcaagacggcgctgatcgaccatttcgacatcgccttcgagctggaggcgacgctg
gccgagcgcggcaagcaggacgcgctcgacatgctgcacgaggaggtgatggagccgggc
tcgatcgtgacggtgcgccagcaggtgccgctcgggcttggccacgcgatctggtgcgcg
cgggccttcatcggcgacgatccgttcgccatcctgctgccggacgacctggtgctgagc
cagaccccctgcctcggccagctcgccgacgcctaccgggcgaccgggggcaatgtcgtc
gccgtcgaggaggtgccgatggagcaggtgcaccgctacggcgtgctcaagaccggggcg
acggagcggaatctggtcgaggtgaaggggctggtcgagaagccgaaacgcgaggaggcg
ccgtcgaatctctcgatcatcgggcgctacgtgctgctgccggaggtgatcggccatctg
gcgcggatggagcgcggcgccggcaacgaggtgcagctgaccgacgcgatggcgaagatg
atcggggcggcgccgttccacgggctgaaattcgaggggcggcggttcgactgcggcgac
aaggcgggctatctggaagcgcagattgccttcggtctggtgcgtccggacctggggccg
tcgatccgtcacttcctgaaggcttattccgatgcatga

DBGET integrated database retrieval system