KEGG   Acidiphilium cryptum: Acry_1236Help
Entry
Acry_1236         CDS       T00527                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acr  Acidiphilium cryptum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acry_1236
   01230 Biosynthesis of amino acids
    Acry_1236
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acry_1236
   00051 Fructose and mannose metabolism
    Acry_1236
   00562 Inositol phosphate metabolism
    Acry_1236
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_1236
Enzymes [BR:acr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acry_1236
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acry_1236
  Exosomal proteins of bladder cancer cells
   Acry_1236
  Exosomal proteins of melanoma cells
   Acry_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1376923..1377684
Genome map
AA seq 253 aa AA seqDB search
MPQLIAGNWKMNGTLAGIAAYAAALRPASPGAELLVCPPAPLIAPLRAALDGAPVALGAQ
DCAVKRSGAHTGDLSADLLAELGATHVILGHSERRADHAESSATVREKARTAIAAGLVPI
ICVGETEAERDSGEAETVVRAQLAGSLPEELAGQTVPGVVAPGIIAYEPVWAIGTGRTPT
EEDVAAMHASIRAALRRQLGAAGATMPILYGGSVKPSNAASLLALPEVGGALVGGASLKA
EDFLAIASAAARD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctgatcgccggaaactggaagatgaacggcaccctcgccggcattgccgcc
tatgccgccgccctgcgtcccgcctccccgggcgcggagctgctggtctgcccgccggcg
ccgctgatcgccccgctgcgcgccgccctcgacggcgccccggtcgccctcggcgcgcag
gactgcgcggtgaagcgctccggcgcgcataccggcgacctctcggccgacctgctggcc
gagctcggcgccacccatgtcatcctcggccattccgagcgccgcgccgatcacgccgaa
tcctccgcgaccgtgcgcgagaaggcgcgcaccgcgatcgccgccggcctggtcccgatc
atctgcgtcggcgaaaccgaggccgagcgcgattccggcgaggccgaaaccgtggtccgc
gcccagctcgccggcagcctgccggaggagctggccggccagaccgtccccggcgtcgtc
gcccccggcatcatcgcctacgagccggtctgggcgatcggcaccggccgcacccccacc
gaggaggacgtcgcggcgatgcacgcctcgatccgcgccgccctgcgccgccagctcggc
gccgccggcgcgacgatgccgatcctctacggcggctcggtcaagccctccaacgcggcg
tccctgctcgccctgcccgaggtcggcggcgccctggtcggcggcgccagcctcaaggca
gaggacttcctggcgattgcctccgccgcggcgcgggactag

DBGET integrated database retrieval system