KEGG   Acidiphilium cryptum: Acry_1236Help
Entry
Acry_1236         CDS       T00527                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acr  Acidiphilium cryptum
Pathway
acr00010  Glycolysis / Gluconeogenesis
acr00051  Fructose and mannose metabolism
acr00562  Inositol phosphate metabolism
acr00710  Carbon fixation in photosynthetic organisms
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
acr01230  Biosynthesis of amino acids
Module
acr_M00002  Glycolysis, core module involving three-carbon compounds
acr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acry_1236
   00051 Fructose and mannose metabolism
    Acry_1236
   00562 Inositol phosphate metabolism
    Acry_1236
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_1236
Enzymes [BR:acr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acry_1236
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acry_1236
  Exosomal proteins of bladder cancer cells
   Acry_1236
  Exosomal proteins of melanoma cells
   Acry_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ30447
UniProt: A5FXW5
Position
1376923..1377684
Genome map
AA seq 253 aa AA seqDB search
MPQLIAGNWKMNGTLAGIAAYAAALRPASPGAELLVCPPAPLIAPLRAALDGAPVALGAQ
DCAVKRSGAHTGDLSADLLAELGATHVILGHSERRADHAESSATVREKARTAIAAGLVPI
ICVGETEAERDSGEAETVVRAQLAGSLPEELAGQTVPGVVAPGIIAYEPVWAIGTGRTPT
EEDVAAMHASIRAALRRQLGAAGATMPILYGGSVKPSNAASLLALPEVGGALVGGASLKA
EDFLAIASAAARD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctgatcgccggaaactggaagatgaacggcaccctcgccggcattgccgcc
tatgccgccgccctgcgtcccgcctccccgggcgcggagctgctggtctgcccgccggcg
ccgctgatcgccccgctgcgcgccgccctcgacggcgccccggtcgccctcggcgcgcag
gactgcgcggtgaagcgctccggcgcgcataccggcgacctctcggccgacctgctggcc
gagctcggcgccacccatgtcatcctcggccattccgagcgccgcgccgatcacgccgaa
tcctccgcgaccgtgcgcgagaaggcgcgcaccgcgatcgccgccggcctggtcccgatc
atctgcgtcggcgaaaccgaggccgagcgcgattccggcgaggccgaaaccgtggtccgc
gcccagctcgccggcagcctgccggaggagctggccggccagaccgtccccggcgtcgtc
gcccccggcatcatcgcctacgagccggtctgggcgatcggcaccggccgcacccccacc
gaggaggacgtcgcggcgatgcacgcctcgatccgcgccgccctgcgccgccagctcggc
gccgccggcgcgacgatgccgatcctctacggcggctcggtcaagccctccaacgcggcg
tccctgctcgccctgcccgaggtcggcggcgccctggtcggcggcgccagcctcaaggca
gaggacttcctggcgattgcctccgccgcggcgcgggactag

DBGET integrated database retrieval system