KEGG   Acidiphilium cryptum: Acry_1243Help
Entry
Acry_1243         CDS       T00527                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
acr  Acidiphilium cryptum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acry_1243
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acry_1243
   00630 Glyoxylate and dicarboxylate metabolism
    Acry_1243
Enzymes [BR:acr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acry_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382808..1384976
Genome map
AA seq 722 aa AA seqDB search
MSQTYVDAAGLRVAAELHQFIETEALPGTGVESGAFWQGFAGLIARHAPRNAELLAERDR
LQAAIDDWHRSRRGQPVDPAAYEAFLREIGYLRPEPGDVKVTSERVDPEIAAIAGPQLVV
PVMNARYALNAANARWGSLYDALYGTDAIPESGGLERGKAYNPQRGAAVVARGRAFLDDH
FPLATGSHADVRAWRVHNGHLAAVLESGETGLKHAAQFAGYRGEPAAPTAVLLRHHNLHV
EIAIDPTSPIGRTDKAGVADLIVESAISTIMDAEDSVAAVDAEDKVLVYRNWLGLMAGTL
SEQVEKGGKTFTRALNPDRAYTAPDGSTLTLPGRVLMLVRNVGHHIYTDTVLDAAGKPIP
ETILDLVVTSLCGLHDIRRTAGLRNSRAGSVYIVKPKMHGADEVAYANGLFAATESLLGL
APDTLKMGIMDEERRTSANLKACIAAAASRIFFINTGFLDRTGDEIHTSIEAGPMIRKNE
IRNTPWIKAYEDRNVDIGIVCGLPGHAQIGKGMWAAPDAMAAMLEQKVGHPRAGANTAWV
PSPTAATLHALHYHMVDVAARQAELAARPMGSLADLLTIPLADRPNWRPEDIQQELDNNA
QGILGYVVRWIDQGIGCSKVPDIHNVALMEDRATLRISAQHIANWLHHGIVSEAQVMETM
KRMAAVVDGQNAGDPAYRNMAPGFDGVAFQAACDLVFKGRTQPNGYTEFILHDRRREAKA
SA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacctatgtggacgcggcgggcctgcgcgtcgccgccgagcttcaccagttc
atcgagaccgaggcgctgcccggcaccggggtcgagtccggcgccttctggcagggtttc
gccggcctcatcgcccgtcacgccccccgcaacgccgagctcctcgccgagcgcgaccgt
ctccaggccgcgatcgacgactggcaccgctcccgccgcggccagccggtcgaccccgcc
gcctacgaggccttcctgcgcgagatcggctacctcaggcccgagcccggcgacgtgaag
gtcacctccgagcgcgtcgatcccgaaatcgccgccatcgccggcccgcagctcgtcgtg
ccggtgatgaacgcccgctacgcgctgaacgccgccaatgcccgctggggcagcctctac
gacgcgctctacggcaccgacgcgattccggagtccggcggcctcgagcgcggcaaggcc
tacaacccgcaacgcggcgccgccgtcgtcgcccgcggccgcgccttcctcgacgatcat
ttcccgctcgccaccggcagccacgccgatgtccgcgcctggcgcgtgcataacggccat
ctcgccgccgtgctcgaaagcggcgagaccggcctgaagcacgccgcccagttcgccggc
tatcgcggcgagcccgccgcccccaccgccgtcctgctccgccaccacaacctgcatgtc
gagatcgcgatcgacccgaccagcccgatcggccgcaccgacaaggccggcgtcgccgac
ctcatcgtcgaatccgcgatcagcacgatcatggacgccgaggacagcgtcgccgccgtc
gatgccgaggacaaggtgctggtctaccgcaactggctcggcctgatggccggcacgctc
agcgaacaggtcgagaagggcggcaagaccttcacccgcgccctcaaccccgaccgcgcc
tacaccgcgccggacggctcgaccctcaccctccccggccgcgtgctgatgctggtccgc
aatgtcggccaccacatctataccgacaccgtgctcgacgccgccggcaagccgatcccc
gagacgatcctcgacctcgtggtcacctccctctgcggcctgcacgacatccgccgcacc
gccggcctgcgcaactcccgcgccggctcggtctacatcgtcaagccgaagatgcacggc
gccgacgaggtcgcctacgccaacggcctcttcgccgcgaccgaatccctgctcggcctc
gccccggacacgctgaagatgggcatcatggacgaggagcgccgcacctcggccaatctc
aaggcctgcatcgccgccgccgccagccgcatcttcttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctcgatcgaggccggcccgatgatccgcaagaacgag
atcaggaacacgccctggatcaaggcctatgaggaccgcaacgtcgatatcggcatcgtc
tgcggcctgcccggccacgcccagatcggcaagggcatgtgggccgcgcccgacgcgatg
gcggcgatgctcgaacagaaggtcggccacccccgcgccggcgccaacaccgcctgggtg
ccctcgcccaccgcggccacgctgcacgccctgcactaccacatggtcgatgtcgccgcc
cgccaggccgagctcgccgcccgcccgatgggctcccttgccgacctgctgaccatcccg
ctggccgaccgcccgaactggcggccggaggacatccagcaggagctcgacaacaacgcc
cagggcatcctcggctacgtcgtccgctggatcgaccagggcatcggctgctccaaggtg
ccggacatccacaacgtcgcgctgatggaagaccgcgccaccctgcgcatctccgcccag
cacatcgccaactggctgcaccacggcatcgtctccgaggcgcaggtgatggagacgatg
aagcgcatggccgcggtggtcgatggccagaacgccggcgacccggcctaccgcaacatg
gccccgggcttcgacggcgtcgccttccaggcggcgtgcgacctcgtcttcaagggccgc
acccagccgaacggctacaccgagttcatcctgcacgaccgccggcgcgaggccaaagcc
tccgcctga

DBGET integrated database retrieval system