KEGG   Acidiphilium cryptum: Acry_1243Help
Entry
Acry_1243         CDS       T00527                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
acr  Acidiphilium cryptum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acry_1243
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acry_1243
   00630 Glyoxylate and dicarboxylate metabolism
    Acry_1243
Enzymes [BR:acr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acry_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382808..1384976
Genome map
AA seq 722 aa AA seqDB search
MSQTYVDAAGLRVAAELHQFIETEALPGTGVESGAFWQGFAGLIARHAPRNAELLAERDR
LQAAIDDWHRSRRGQPVDPAAYEAFLREIGYLRPEPGDVKVTSERVDPEIAAIAGPQLVV
PVMNARYALNAANARWGSLYDALYGTDAIPESGGLERGKAYNPQRGAAVVARGRAFLDDH
FPLATGSHADVRAWRVHNGHLAAVLESGETGLKHAAQFAGYRGEPAAPTAVLLRHHNLHV
EIAIDPTSPIGRTDKAGVADLIVESAISTIMDAEDSVAAVDAEDKVLVYRNWLGLMAGTL
SEQVEKGGKTFTRALNPDRAYTAPDGSTLTLPGRVLMLVRNVGHHIYTDTVLDAAGKPIP
ETILDLVVTSLCGLHDIRRTAGLRNSRAGSVYIVKPKMHGADEVAYANGLFAATESLLGL
APDTLKMGIMDEERRTSANLKACIAAAASRIFFINTGFLDRTGDEIHTSIEAGPMIRKNE
IRNTPWIKAYEDRNVDIGIVCGLPGHAQIGKGMWAAPDAMAAMLEQKVGHPRAGANTAWV
PSPTAATLHALHYHMVDVAARQAELAARPMGSLADLLTIPLADRPNWRPEDIQQELDNNA
QGILGYVVRWIDQGIGCSKVPDIHNVALMEDRATLRISAQHIANWLHHGIVSEAQVMETM
KRMAAVVDGQNAGDPAYRNMAPGFDGVAFQAACDLVFKGRTQPNGYTEFILHDRRREAKA
SA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacctatgtggacgcggcgggcctgcgcgtcgccgccgagcttcaccagttc
atcgagaccgaggcgctgcccggcaccggggtcgagtccggcgccttctggcagggtttc
gccggcctcatcgcccgtcacgccccccgcaacgccgagctcctcgccgagcgcgaccgt
ctccaggccgcgatcgacgactggcaccgctcccgccgcggccagccggtcgaccccgcc
gcctacgaggccttcctgcgcgagatcggctacctcaggcccgagcccggcgacgtgaag
gtcacctccgagcgcgtcgatcccgaaatcgccgccatcgccggcccgcagctcgtcgtg
ccggtgatgaacgcccgctacgcgctgaacgccgccaatgcccgctggggcagcctctac
gacgcgctctacggcaccgacgcgattccggagtccggcggcctcgagcgcggcaaggcc
tacaacccgcaacgcggcgccgccgtcgtcgcccgcggccgcgccttcctcgacgatcat
ttcccgctcgccaccggcagccacgccgatgtccgcgcctggcgcgtgcataacggccat
ctcgccgccgtgctcgaaagcggcgagaccggcctgaagcacgccgcccagttcgccggc
tatcgcggcgagcccgccgcccccaccgccgtcctgctccgccaccacaacctgcatgtc
gagatcgcgatcgacccgaccagcccgatcggccgcaccgacaaggccggcgtcgccgac
ctcatcgtcgaatccgcgatcagcacgatcatggacgccgaggacagcgtcgccgccgtc
gatgccgaggacaaggtgctggtctaccgcaactggctcggcctgatggccggcacgctc
agcgaacaggtcgagaagggcggcaagaccttcacccgcgccctcaaccccgaccgcgcc
tacaccgcgccggacggctcgaccctcaccctccccggccgcgtgctgatgctggtccgc
aatgtcggccaccacatctataccgacaccgtgctcgacgccgccggcaagccgatcccc
gagacgatcctcgacctcgtggtcacctccctctgcggcctgcacgacatccgccgcacc
gccggcctgcgcaactcccgcgccggctcggtctacatcgtcaagccgaagatgcacggc
gccgacgaggtcgcctacgccaacggcctcttcgccgcgaccgaatccctgctcggcctc
gccccggacacgctgaagatgggcatcatggacgaggagcgccgcacctcggccaatctc
aaggcctgcatcgccgccgccgccagccgcatcttcttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctcgatcgaggccggcccgatgatccgcaagaacgag
atcaggaacacgccctggatcaaggcctatgaggaccgcaacgtcgatatcggcatcgtc
tgcggcctgcccggccacgcccagatcggcaagggcatgtgggccgcgcccgacgcgatg
gcggcgatgctcgaacagaaggtcggccacccccgcgccggcgccaacaccgcctgggtg
ccctcgcccaccgcggccacgctgcacgccctgcactaccacatggtcgatgtcgccgcc
cgccaggccgagctcgccgcccgcccgatgggctcccttgccgacctgctgaccatcccg
ctggccgaccgcccgaactggcggccggaggacatccagcaggagctcgacaacaacgcc
cagggcatcctcggctacgtcgtccgctggatcgaccagggcatcggctgctccaaggtg
ccggacatccacaacgtcgcgctgatggaagaccgcgccaccctgcgcatctccgcccag
cacatcgccaactggctgcaccacggcatcgtctccgaggcgcaggtgatggagacgatg
aagcgcatggccgcggtggtcgatggccagaacgccggcgacccggcctaccgcaacatg
gccccgggcttcgacggcgtcgccttccaggcggcgtgcgacctcgtcttcaagggccgc
acccagccgaacggctacaccgagttcatcctgcacgaccgccggcgcgaggccaaagcc
tccgcctga

DBGET integrated database retrieval system