KEGG   Acidiphilium cryptum: Acry_1328Help
Entry
Acry_1328         CDS       T00527                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acr  Acidiphilium cryptum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acry_1328
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acry_1328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acry_1328
Enzymes [BR:acr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acry_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1484503..1485717
Genome map
AA seq 404 aa AA seqDB search
MNKPIPNSLRTLPDDRGRFGEFGGRFVAETLMPLILELEAAYEAAKDDPDFMREFQYYLQ
HYVGRPSPLWFAERLTKELGGAKVYFKRDELNHTGAHKINNCIGQILLAKRMGKTRIIAE
TGAGQHGVATATVAALFGLPCIVYMGATDVERQQPNVFRMKLLGAEVRPVTSGASTLKDA
MNEALRDWVANVRDTFYIIGTAAGPHPYPAMVRDFQSVIGVEARAQMMEAEGRLPDVAIA
AIGGGSNAIGLFHAFLDEQVKLIGVEAAGRGLDSGEHAASLSRGRPGVLHGNRTYLLQDD
DGQILEAHSISAGLDYPGIGPEHSYLHDIGRVEYVSATDDEALAAFQLCCRTEGIIPALE
PSHALAHVAKIAPGMDKESIILMNLCGRGDKDIFTVARHLGEQI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgatacccaattccctgcgcaccctgcccgacgaccgcggccgcttcggc
gagttcggcggcaggttcgtcgccgaaaccctgatgccgctgatcctcgagctcgaggcg
gcctacgaggcggcgaaggacgatcccgatttcatgcgggaattccagtattacctgcaa
cattatgtcggccgccccagcccgctctggttcgccgagcggctgacgaaagagctcggc
ggcgccaaggtctatttcaagcgcgacgagctgaaccacaccggcgcgcacaagatcaac
aactgcatcggccagatcctgctcgccaagcgcatgggcaagacgcgcatcatcgccgag
accggcgccggccagcacggcgtcgccaccgcgacggtggccgccctcttcggcctgccc
tgcatcgtctacatgggcgccaccgatgtcgagcggcagcagcccaacgtcttccgcatg
aagctgctcggcgccgaggtccgccccgtgacctccggcgcgtcgacgctgaaggacgcg
atgaacgaggcgctgcgcgactgggtcgcgaatgtgcgcgacaccttctacatcatcggc
accgccgccggcccgcacccctatcccgccatggtgcgggacttccagtcggtcatcggg
gtcgaggcccgcgcccagatgatggaggccgagggccgcctgccggatgtcgcgatcgcg
gcgatcggcggcggctccaacgccatcggcctgttccacgccttcctcgacgagcaggtg
aagctgatcggcgtcgaggccgccgggcgcggcctcgattcgggcgagcacgccgcctcc
ctctcgcgcggccgccccggcgtgctgcacggcaaccgcacctacctgctgcaggacgat
gacggccagatcctcgaggcccactcgatctccgccgggctcgactatccgggcatcggc
cccgagcattcctacctgcacgatatcggccgcgtggaatacgtgtccgcgaccgacgac
gaggccctcgccgccttccagctctgctgccgcaccgagggcatcatccccgccctcgag
ccctcgcacgccctcgcccatgtcgcgaagatcgcccccggcatggacaaggagagcatc
atcctgatgaatctctgcggccgcggcgacaaggacatcttcaccgtcgcccgccatctc
ggagaacagatttga

DBGET integrated database retrieval system