KEGG   Acidiphilium cryptum: Acry_1329Help
Entry
Acry_1329         CDS       T00527                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acr  Acidiphilium cryptum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acry_1329
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acry_1329
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acry_1329
Enzymes [BR:acr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acry_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1485714..1486544
Genome map
AA seq 276 aa AA seqDB search
MSRIAATFARLRDEGRAGLIPFVEAFDPDRETSATLLAGMAARGADLIEIGMPFTDPMAD
GPTIQQAGRRALRAGATLAGTLGLVRDFRAVNDTVPLILMGYLNPILSYGVERFTADAAA
AGVDGVIVVDLPTEEADLLLPHLRQHRIDLIRLVAPTTTDERLPVVLNDSSGFVYYVSIT
GITGTRTASAEDLARDIPRVRKATDMPIAVGFGVRTPAQAATVARFADAAVVASALIDKL
AAGLDADGKAPPAIVEAVLDDVAALAAAVRGERRAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgcatcgccgccaccttcgcccgcctccgcgatgagggccgggcgggcctgatc
cccttcgtcgaggcgttcgaccccgatcgcgaaacctccgccaccctgctcgccggcatg
gccgcccgcggcgccgacctgatcgagatcggcatgccctttaccgacccgatggcggac
ggcccgaccatccagcaggccggccgccgggcgctgcgcgccggtgcgaccctcgccggc
acgctcggcctggtgcgcgacttccgcgctgtcaacgacaccgtgccgctgatcctgatg
ggctatctcaaccccatcctctcctacggcgtcgagcgcttcaccgccgatgccgccgcc
gccggcgtcgatggcgtcatcgtcgtcgacctgccgaccgaggaggccgacctgctgctg
ccgcatctgcgccagcaccgcatcgacctcatccgcctcgtcgcccccaccacgacggac
gagcgcctgcccgtcgtgctcaacgactcctccggcttcgtctattacgtctcgatcacc
ggcatcaccggcacccgcaccgcctccgccgaggatctcgcgcgcgacatcccccgcgtc
cgcaaggcgacggacatgccgatcgccgtcggcttcggcgtccgcacccccgcccaggcc
gcaacggtggcgcggttcgccgatgccgccgtggtcgcctcggcgctgatcgacaagctc
gccgccggcctcgatgccgacggcaaggccccgcccgccatcgtcgaggcggtgctggac
gatgtcgccgccctggccgcggcggtgcgcggcgagcgccgcgccgcctga

DBGET integrated database retrieval system