KEGG   Acidiphilium cryptum: Acry_1625Help
Entry
Acry_1625         CDS       T00527                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acr  Acidiphilium cryptum
Pathway
acr00020  Citrate cycle (TCA cycle)
acr00640  Propanoate metabolism
acr00660  C5-Branched dibasic acid metabolism
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
Module
acr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acry_1625
   00640 Propanoate metabolism
    Acry_1625
   00660 C5-Branched dibasic acid metabolism
    Acry_1625
Enzymes [BR:acr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acry_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABQ30831
UniProt: A5FYZ9
Position
complement(1795763..1796959)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKELLKSYGVAVLDGHVAWTGEEAAEAARKLPGPVYVVKSQIHAGGRGAGHFK
DDPEGKGGVRLAKSPEEVAAAAEAMLGNTLVTKQTGPAGRVVRRVYVEAGCDIKRELYLS
LLVDRAKSEIVIMASTEGGMEIEEVAEKHPEKILRVAVDPASGISGFHARRLGFGLGLDA
TQMKAFAKFVNAMYKAFVALDCAIVEINPLVVTGAGEVVALDAKVSFDDNALYRHPDLEK
LRDEAEEDPKELEAAKHSLNYVALDGSIGCMVNGAGLAMATMDIIKLYGAEPANFLDVGG
GATKERVTAAFKIILSDPNVEGILVNIFGGIMRCDVIAEGVVAAAREVSLSVPLVVRLEG
TNVQLGKDILSKSGLPIIAADNLADAAQKIVAAVKEAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgaataccaggccaaggaactgctgaagtcctatggcgtcgcggtgctg
gacgggcacgtcgcctggaccggcgaggaggccgccgaggcggcgcgcaagctccccggc
ccggtttatgtcgtgaagtcgcagatccatgccggcggccgcggcgccggccatttcaag
gacgatccggagggcaagggcggtgtccgcctcgccaagtcgcccgaggaggttgccgcc
gccgccgaggcgatgctgggcaacacgctggtgaccaagcagaccggcccggccggccgc
gtcgtccgccgcgtctatgtcgaggccggctgcgacatcaagcgcgagctctacctctcg
ctgctggtcgaccgcgcgaaatccgagatcgtcatcatggcctcgaccgagggcggcatg
gagatcgaggaagtcgccgagaagcatcccgagaagatcctccgcgtcgcggtcgatccg
gcgagcggcatctccggcttccacgcccgccgcctcggcttcggcctcgggctcgacgcc
acccagatgaaggccttcgcgaaattcgtgaacgcgatgtacaaggccttcgtcgcgctc
gactgcgcgatcgtcgagatcaacccgctggtcgtcaccggcgccggcgaggtggtcgct
ctcgacgccaaggtcagcttcgacgacaatgcgctctaccgtcaccccgatctcgagaag
ctgcgcgacgaggccgaggaagacccgaaggaactcgaggccgccaagcacagcctgaac
tacgtggcgctggacggctcgatcggctgcatggtcaacggcgccggcctcgcgatggcg
acgatggacatcatcaagctctacggcgcggagccggcgaacttcctcgatgtcggcggc
ggggcgaccaaggagcgcgtcaccgcggccttcaagatcatcctgtcggacccgaatgtc
gaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacgtgatcgccgagggc
gtggtcgccgcggcgcgcgaggtctcgctctcggtgccgctggtcgtccgcctcgagggc
accaacgtgcagctcggcaaggacatcctctccaaatccggcctgcccatcatcgcggcc
gacaatctcgctgacgcggcgcagaagatcgtcgccgccgtgaaggaggccgcataa

DBGET integrated database retrieval system