KEGG   Acidiphilium cryptum: Acry_1683Help
Entry
Acry_1683         CDS       T00527                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
acr  Acidiphilium cryptum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acry_1683
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acry_1683
Enzymes [BR:acr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Acry_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1858127..1859638
Genome map
AA seq 503 aa AA seqDB search
MSATSPLSHDRPNRSWLERLWSSIAEHGRVFVNLPNDDLPSRERAELLADALLGGRGEAS
GAALAAALLGTLRGLAPHERITFCEFLATGFEPDADRLQDAARAYLASPDAATAAALATA
AEPPRQELLRRMNMAPGGTGALIDMRREVLAELPKRPSLAPLDSDLRHLFASWFNRGFLE
LRRIDWRTPAFILEKLIAYEAVHEIQGWDDLRRRLAPDRRCFAFFHPALPDEPLIFVEVA
LVKGLAEAIGPLLAPAADDDAAEHAQQDAAARANTAIFYSISNCQEGLRGISFGNFLIKQ
VVAELQSELANLRKFSTLSPVPGLRRAIRAVLDSPSAPLLAAEEREAIGRALGTAPAADT
SAEGDANLLKSILEDRPWWTEAPLAAALRGPLLRLAALYLTGAWRANGVPAAARPDPVAR
FHLGNGARLERINWLGNTSPRGIAESFGVMVNYLYDPDAIEARHEAYLRDGTVARAAAVD
QLMAPPGQSWLARRTRGLITTES
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacgtcccccctttcgcacgatcgccccaaccgctcctggcttgaacgcctc
tggtcgtcgatcgccgagcacgggcgcgtcttcgtcaatctgccgaatgacgatcttccc
tcgcgcgagcgggcggagcttctggccgatgccctgctgggcgggcgtggcgaagcctcc
ggcgcggccctcgccgctgccctgctcggcacgctgcgcggcctcgcgccgcatgagcgg
atcacgttctgcgaattcctcgccaccggcttcgagccggacgcggaccgcctccaggac
gccgcccgcgcctatctggcatcgcccgacgcggccaccgccgccgccctcgccacagcc
gccgagccgccccgccaggaactcctgcgccggatgaacatggcgcccggcggcaccggc
gcgctgatcgacatgcgccgggaggtgctggccgaactgccgaaacgcccgagccttgct
ccgctcgattccgaccttcggcacctcttcgcatcctggttcaaccgcggcttcctggag
ctccgccggatcgactggcgcaccccggccttcattctcgaaaagctcatcgcctacgag
gcggtgcacgaaatccagggctgggacgacctgcgccgccgcctcgcccccgatcgccgc
tgcttcgccttcttccatcccgccctgccggacgagccgctgatcttcgtcgaggtcgcg
ctggtcaaggggctggccgaggcgatcggcccgctgctggccccggccgccgacgatgat
gccgccgagcatgcccagcaggatgccgcagcacgggcaaatacggcgatcttctattcg
atatcgaactgccaggagggcctgcgcggcatctccttcggcaatttcctgatcaagcag
gtcgttgccgaactccagtccgaactggcaaacctgcggaaattctcgaccctgtccccc
gttcccggcctgcgccgcgccatccgcgcggtgctggactcgccctccgccccgctgctt
gccgccgaggagcgcgaggcgatcggccgcgcgctcggcaccgccccggcggccgatacc
tccgccgaaggcgacgccaatctgctcaaatcgattctcgaggaccgcccatggtggacc
gaagcgccgctcgccgcagcgttgcgcggccccctgctgcgcctcgccgcgctctatctg
accggcgcctggcgcgcgaacggcgttccggccgcggcccggcccgacccggtggcccgc
ttccatctcggcaatggcgcgcgtctcgaacggatcaactggctcggcaacacgagtccg
cgtggcatcgccgagtcgttcggcgtgatggtgaactatctctacgatcccgatgcgatc
gaggcgcggcacgaagcctatctgcgcgacggaacggtggcgcgcgccgccgcggtcgac
cagctgatggcgccgccgggccagtcctggctggcccggcgcacgcgcgggctcatcacc
accgaaagctga

DBGET integrated database retrieval system