KEGG   Acidiphilium cryptum: Acry_1780Help
Entry
Acry_1780         CDS       T00527                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acr  Acidiphilium cryptum
Brite
Enzymes [BR:acr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Acry_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1960352..1961014
Genome map
AA seq 220 aa AA seqDB search
MSDNERYFRDARTLMVDGQIRPNNIADDRVITAMRTIRRERFCPPAQTGRAYSDADLPLG
HGRFMPAPLTIARLAQAAATHPGTRVLVVGANTGYGAAVLASGGAAVVALEEDEALRAMA
AEALAAEAADVRLVAGPLAAGAPAQAPFDVIVIEGAVDMLPAAFAAQLAPGGRLVTILND
DGIGRLVVAEAVGGAFAHRTLADRNAPLLASFQRKAAFSF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaatgaacggtatttccgcgacgcccgcaccctgatggtggacggccagatc
cggcccaacaatatcgcggatgaccgggtcatcaccgcgatgcggacgatccggcgcgag
cggttctgcccgccggcgcagacgggccgcgcctattccgatgccgacctgccgctcggc
catggccggttcatgccggcgccgctgacgatcgcgcgtctggcgcaagccgccgccacg
catccgggcacgcgggtgctggtggtgggggccaacaccggctacggcgccgcggtgctc
gcctccggcggcgcggcggtggtggctctcgaggaagacgaggcgctgcgcgccatggcg
gcggaagcgctggcggcggaggcggcggatgtgaggctggtggccgggccgcttgcggcc
ggggcgccggcgcaggcgccgttcgacgtcatcgtgatcgagggcgcggtggacatgctg
ccggcggccttcgcggcgcaactggcgccggggggccggctcgtcaccatcctgaacgat
gacggcatcggccggctggtggttgccgaggcggtgggcggcgccttcgcgcaccggacg
cttgccgaccggaacgcgccgttgttagcatcgttccagcgtaaggcggcattcagtttt
tga

DBGET integrated database retrieval system