KEGG   Acidiphilium cryptum: Acry_1787Help
Entry
Acry_1787         CDS       T00527                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acr  Acidiphilium cryptum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acry_1787
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acry_1787
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acry_1787
Enzymes [BR:acr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acry_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1969591..1970994)
Genome map
AA seq 467 aa AA seqDB search
MRYVSTRGAAPSREFDDVLLAGLAEDGGLFVPETWPVFSPAEWRALRGLPYAELAARVMA
PFMTGGAIGFDDLQAITRASYRGFDHAAVVPLVQLEPSLFVLELFHGPTLAFKDLALQVA
GRLFDHVLSARDERVTIVGATSGDTGSAAIEACRDRLRVDIAILHPEGRTSEVQRRQMTT
VKARNVLNIALSGTFDDCQDLVKAMFADAPFRTELRLSAVNSINWARIAGQIPYFAAAAL
ALGAPDRPVAVAVPTGNFGNILAAWAARQMGLPIERFIVGSNANDILARFLAANDMRTAG
VVETVSPSMDIQVSSNFERLLFEALGRDAPETAHTMVDFRASGTMKVSREVWQSVRRDFA
GLALDDAATLAEIARIRAESGYIADPHTAIGIAAARAAAPVGVPVIAAATAHPAKFPAAM
HRAIGIRPGLPPRLDDLYDRQEHFVRAGNSLGEVETLVRHFAHRNDA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctccacccgcggtgcggccccgtcccgtgaattcgacgatgtcctgctg
gccgggctggccgaggatggcgggctgttcgtgcccgagacctggccggtcttctcgccg
gcggaatggcgcgcgctgcgcggcctgccctatgccgagctcgccgcccgcgtcatggcc
ccgttcatgaccggcggcgccatcggcttcgacgatctgcaagccatcacccgcgcgtcc
tatcgcgggttcgaccatgcggcggtcgtcccgctggtccagctcgaaccctcgctcttc
gtgctggaactgttccacggcccgaccctcgccttcaaggatctcgccctccaggtcgcc
ggccgcctgttcgaccatgtcctgtccgcccgcgacgagcgggtgacgatcgtgggcgcc
acctcgggcgataccggctccgccgcgatcgaggcctgccgcgaccgcctgcgggtcgac
atcgccatcctccaccccgaaggccgcacctccgaggtccagcgccggcagatgaccacg
gtcaaggcccgcaacgtcctcaacatcgccctctccggcacgttcgacgactgccaggac
ctggtgaaggcgatgttcgccgatgcgcccttccgcaccgagctgcgcctgtcggcggtc
aactcgatcaactgggcgcgcatcgccggccagatcccctatttcgccgccgccgccctc
gccctcggcgcgccggaccgcccggtcgccgtcgcggtgccgaccggcaatttcggcaac
atcctcgccgcctgggcggcgcggcagatgggcctgccgatcgagcgcttcatcgtcggc
agcaacgcgaacgacatcctcgcccgcttcctcgccgccaacgacatgcgcaccgccggc
gtggtcgaaaccgtctccccctcgatggacatccaggtcagctcgaatttcgagcgcctc
ctgttcgaggcgctgggcagggatgcgccggagaccgcccacaccatggtcgatttccgc
gccagcggcacgatgaaggtctcccgcgaggtctggcagtcggtccggcgcgacttcgcc
ggcctcgccctcgacgatgcggcgacccttgccgaaatcgcccgcatccgcgccgagtca
ggctacatcgccgacccgcataccgcgatcggcatcgccgccgcccgcgccgccgccccg
gtcggcgtgccggtcatcgccgcggcgaccgcgcatcccgccaagttcccggcggcgatg
catcgcgcgatcggcattcgcccggggctgccgccgcggctcgacgacctatatgaccgt
caggaacatttcgtacgcgcgggcaacagcctcggcgaggtcgagaccctggtccgccat
ttcgcgcacaggaacgatgcatga

DBGET integrated database retrieval system