KEGG   Acidiphilium cryptum: Acry_1880Help
Entry
Acry_1880         CDS       T00527                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
acr  Acidiphilium cryptum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acry_1880
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acry_1880
   00650 Butanoate metabolism
    Acry_1880
  Energy metabolism
   00190 Oxidative phosphorylation
    Acry_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2071606..2071983
Genome map
AA seq 125 aa AA seqDB search
MRIMRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYM
AEPWNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISV
LKLSF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcatgcgttcggcactcggccgcgcccgcggcatgggggccgcgaaatcgggc
gtgcatcactggtgggcgcagcggctgaccgcgctggcgctgctgccgctcgcgctctac
gccgtgctgtcggtgctgctgctggagggcgcgagccaggccgagatgctgcgctacatg
gccgagccgtggaacggggtgctgttcctcgccctcgtgatcgcgctgttctatcacctg
cagctgggtttgcaggtggtgatcgaggactacatccgctccgagggcaagcggctcgcg
gtcatgctcgcgatgcgggcgacggccgggttcttcgggctgctggccatcatctcggtc
ctgaaactgtccttctga

DBGET integrated database retrieval system