KEGG   Acidiphilium cryptum: Acry_1998Help
Entry
Acry_1998         CDS       T00527                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
acr  Acidiphilium cryptum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acry_1998
DNA repair and recombination proteins [BR:acr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Acry_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2190895..2191485)
Genome map
AA seq 196 aa AA seqDB search
MMGPEIERLVGLMARLPGLGPRSARRIVLRLMAEREQRLLPLIAALDAACQRVAVCPVCG
GLDSQQPCMICADAAREPLICVVETVADQWALERAAVYRGRYHVLGGLLSAIAGHGPEDL
GIDRLVARLDGSVREVILALPATVDGQATAHYLTERLATCGVSVTRLAQGVPVGGSIEIL
DEGTLALALSARRAAG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcccggagatcgagcggctggtcgggctgatggcgcggctgccgggtctcggg
ccgcgttcggcgcggcgcatcgtgctgcggctgatggccgagcgcgagcagcgcctgctg
ccgctgatcgcggcccttgatgccgcttgccagcgcgtcgccgtctgcccggtttgcggc
ggactggattcccaacaaccctgcatgatctgcgccgatgccgcccgcgaaccgctgatc
tgcgtggtcgagacggtggccgatcaatgggcgctggaacgcgcggcagtctatcgcggc
cgctatcatgtcctcggcggcctgttgtcggccattgccggccatggccccgaagatctt
ggcatcgaccgactcgtcgcccggctcgacggatcggtgcgcgaggtgattctcgccctg
ccggccaccgtcgatggccaggccaccgcgcattatctcaccgaacggctcgcaacctgt
ggcgtgagcgttacccggcttgcccagggcgttcccgtcggcggcagtatcgaaatcctc
gacgagggcacactcgccctcgcgctttccgcccgccgcgctgccggatga

DBGET integrated database retrieval system