KEGG   Acidiphilium cryptum JF-5: Acry_2099Help
Entry
Acry_2099         CDS       T00527                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:acr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:acr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324679..2325050)
Genome map
AA seq 123 aa AA seqDB search
MKSTLLIAVAAGAFCIASAQAANVAHGKALFQAQCAACHSVSPGQNGIGPSLAGVYGAKA
AATPGFQFSPALKKSGIVWNASTLDKFLANPQADVPGTKMPYMGMANATDRADVVAYLQT
LGK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccactcttctcatcgccgttgccgcgggtgcattctgcatcgcgagcgcgcag
gcggcgaacgtggcacatggcaaggcactgtttcaggcccagtgcgcagcctgccatagc
gtgagcccggggcagaacgggatcggcccgtcattggcgggcgtctacggcgcgaaggcc
gctgcgaccccgggattccagttctccccggcgctcaagaagtccggtatcgtgtggaac
gcctcgacgctcgacaagttcctggccaatccgcaggcggatgtgccgggcaccaagatg
ccctatatgggcatggccaatgccaccgatcgggccgacgtggtcgcctatctgcagacg
ctcggcaaataa

DBGET integrated database retrieval system