KEGG   Acidiphilium cryptum JF-5: Acry_2124Help
Entry
Acry_2124         CDS       T00527                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Class
Metabolism; Overview; Carbon metabolism [PATH:acr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:acr01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:acr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:acr00051]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:acr00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2351345..2351797)
Genome map
AA seq 150 aa AA seqDB search
MSENMTLVVGADHAGFELKDRLAEAARAAGWAVIDCGTNSAASVDYPDIAHEVSMRIEAG
SARFGLLVCGSGIGMAIAANRHTGVRCAQAHDATEARLSRMHNNANILALGARLTGEMVA
LDALNAFLTTEFEGGRHEKRLAKLTPEPKT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacatgacactggtggtcggcgccgaccatgcggggttcgaattgaaggac
cggctggcagaggccgcgcgcgccgccggctgggcggtgatcgattgcggcacgaattcg
gccgcgagcgtggattatcccgatatcgcgcatgaggtgagcatgcggatcgaggccgga
tcggcccgtttcggcctccttgtgtgcggttccggcatcggcatggcgatcgcggcgaac
cgccacaccggcgttcgttgcgcgcaggcccatgatgcaaccgaggcgcgcctttcgcgc
atgcacaataatgccaatatcctcgccctgggtgcccggctgaccggcgaaatggtcgcg
ctggacgcgctcaatgcgtttctgaccaccgaattcgaaggcggccggcacgagaagagg
ctcgccaaactgaccccggagccgaaaacatga

DBGET integrated database retrieval system