KEGG   Acidiphilium cryptum: Acry_2124Help
Entry
Acry_2124         CDS       T00527                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
acr  Acidiphilium cryptum
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acry_2124
   01230 Biosynthesis of amino acids
    Acry_2124
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acry_2124
   00051 Fructose and mannose metabolism
    Acry_2124
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_2124
Enzymes [BR:acr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Acry_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2351345..2351797)
Genome map
AA seq 150 aa AA seqDB search
MSENMTLVVGADHAGFELKDRLAEAARAAGWAVIDCGTNSAASVDYPDIAHEVSMRIEAG
SARFGLLVCGSGIGMAIAANRHTGVRCAQAHDATEARLSRMHNNANILALGARLTGEMVA
LDALNAFLTTEFEGGRHEKRLAKLTPEPKT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacatgacactggtggtcggcgccgaccatgcggggttcgaattgaaggac
cggctggcagaggccgcgcgcgccgccggctgggcggtgatcgattgcggcacgaattcg
gccgcgagcgtggattatcccgatatcgcgcatgaggtgagcatgcggatcgaggccgga
tcggcccgtttcggcctccttgtgtgcggttccggcatcggcatggcgatcgcggcgaac
cgccacaccggcgttcgttgcgcgcaggcccatgatgcaaccgaggcgcgcctttcgcgc
atgcacaataatgccaatatcctcgccctgggtgcccggctgaccggcgaaatggtcgcg
ctggacgcgctcaatgcgtttctgaccaccgaattcgaaggcggccggcacgagaagagg
ctcgccaaactgaccccggagccgaaaacatga

DBGET integrated database retrieval system