KEGG   Acidiphilium cryptum: Acry_2288Help
Entry
Acry_2288         CDS       T00527                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acr  Acidiphilium cryptum
Pathway
acr00010  Glycolysis / Gluconeogenesis
acr00620  Pyruvate metabolism
acr00640  Propanoate metabolism
acr00680  Methane metabolism
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acry_2288
   00620 Pyruvate metabolism
    Acry_2288
   00640 Propanoate metabolism
    Acry_2288
  Energy metabolism
   00680 Methane metabolism
    Acry_2288
Enzymes [BR:acr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Acry_2288
Lipid biosynthesis proteins [BR:acr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Acry_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABQ31483
UniProt: A5G0V1
Position
complement(2517021..2518955)
Genome map
AA seq 644 aa AA seqDB search
MSQPETIPVKPEIAANALVDRARYDDMARRAAENPEAFWAEESKRITWMTPPTRIKNVTF
TGNVSIKWFEDGVLNASANCLDRHLATRGDQVAIIWEGDDPGEQKHVTYRELHAEVCRMA
NVLKSLGVRKGDRVTVYMPMIVEAAVAILACARIGAVHSVVFGGFSPDSLANRIQDCDSS
ILITADEGRRGGRKVPLKANVDAAAKSCPMLKKVVVVKATGGQVDMQDGRDVWYHEAAAT
MPLDCPPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVWASFTHQYVFDYHDGEVYWC
TADVGWVTGHTYIVYGPLANGATTLMFEGIPNYPDTSRFWQVVDKHKVNIFYTAPTAIRA
LMRDGEGPVKKTSRASLRVLGSVGEPINPEAWLWYYRVVGDQRCPIVDTWWQTETGGILI
SALPGAIDQKPGSATLPLPGVKPVLVDGDGNVLEGATEGNLCLADSWPGQMRTVYGDHER
FIQTYFSTFRGFYFSGDGARRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVAHAKVA
EAAVVGFPHDIKGQGIYAYVTLVAGEEPTEELRKELVMWVRKEIGPIAAPDAIQWAPGLP
KTRSGKIMRRILRKIAANETDSLGDTSTLADPAVVDDLVRNRMA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcccgaaaccattcccgtgaagccggagatcgccgctaacgcgcttgtcgat
cgtgcgagatacgacgacatggcgcgccgcgcggcggaaaatcccgaggcgttctgggcc
gaggaatccaagcgcatcacctggatgacgccgccgacccgcatcaagaacgtcaccttc
accggcaatgtctcgatcaagtggttcgaggacggcgtgctgaacgcatcggccaactgt
ctcgaccggcatctcgccacccgcggcgaccaggttgcgatcatctgggaaggtgacgat
cccggcgaacagaagcatgtgacctatcgcgagttgcacgccgaagtgtgccgcatggcg
aatgtgttgaagtcgctcggcgtgcggaagggcgaccgcgtcaccgtctacatgccgatg
atcgtcgaggcggcggtggcgattctcgcctgcgcgcgcatcggcgcggttcattccgtg
gtgttcggcgggttctcgccggacagcctcgccaaccgcatccaggattgcgacagctcg
atcctgatcaccgccgatgaaggccgccgcggcggccgcaaggtgccgctgaaggccaat
gtcgatgccgcggcgaaatcctgcccgatgctgaagaaggttgtcgtggtgaaggcgacc
ggcggccaggtcgacatgcaggacggccgcgacgtctggtatcacgaggcggcggcgacc
atgccgctcgactgcccccccgagccgatgaatgccgaggacccgctcttcatcctctac
acctccggctccaccggcaagcccaagggcgtgctgcacacgaccggtggttacatggtc
tgggcgagcttcacccaccagtatgtgttcgattaccatgacggcgaggtctactggtgc
accgccgatgtcggctgggtgaccggccatacctatatcgtctatggtccgctcgccaac
ggcgccaccacgctgatgttcgaggggattccgaactaccccgacaccagccgcttctgg
caggtggtggacaagcacaaggtcaacatcttctacaccgccccgaccgcgatccgcgcg
ctgatgcgcgacggcgaggggccggtgaaaaagacctcgcgcgcctcgctgcgggtgctg
ggttcggtcggcgagccgatcaatcccgaagcgtggctttggtactatcgcgtcgtcggc
gaccagcgctgcccgatcgtcgatacctggtggcagaccgaaaccggcggcatcctgatc
tcggcgctgcccggcgcgatcgaccagaagccgggctcggcgacgctgccgctgcccggc
gtgaagccggttctggtcgatggcgacggcaacgtcctggaaggggcgactgaaggcaat
ctctgcctcgccgacagctggcccggccagatgcggacggtttacggcgatcacgagcgg
ttcatccagacctatttctcgaccttccggggcttctacttctccggcgacggcgcccgc
cgcgacgaggatggatattactggatcaccggccgggtagacgacgtcatcaacgtctcc
ggccaccggatgggcacggccgaggtcgagagcgcgctggtcgcgcacgccaaggtggcc
gaggccgcggtggtgggcttcccgcacgacatcaagggacagggcatctacgcctatgtg
acgctcgtcgccggcgaggagccgaccgaggaactgcgcaaggaactggtgatgtgggtc
cgcaaggaaatcggcccgatcgctgcgccggatgcgatccagtgggcgcccggcctgccc
aagacgcgctcgggcaagatcatgcgccgaatcctgcgcaagatcgccgcgaatgagacc
gacagcctgggtgatacctcgaccctcgccgacccggcggtggtcgacgatcttgtccgc
aaccggatggcctga

DBGET integrated database retrieval system