KEGG   Acidiphilium cryptum JF-5: Acry_2384Help
Entry
Acry_2384         CDS       T00527                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:acr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2622868..2624367)
Genome map
AA seq 499 aa AA seqDB search
MSRYVGAIDQGTTSSRFIVFDKGGNIVSVAQKEHRQIYPKPGWVEHDPMEILSNTNEVIG
AALARANLTASDLAAVGITNQRETTLLWDRKTGQPLCNALVWMDTRTDQLVQQFTRDGGQ
DRFRAKTGLPLATYFAGLKLRWILDNVEGAKAKAEAGDALFGTVDSWLTWNLTGGVNGGH
HVTDVTNASRTMLIDLATCAWDDDMLNAFGIPRACLPKIVPSSAVYGEIRTAPLQGTKLA
GMLGDQQAALVGQTCFAPGEAKNTYGTGSFLLMNTGTEPVQSKAGLLTTLAYQLGDEKPR
YALEGAIAITGALVQWLRDNLKLFDVAPQIEPLARSVEDNGDVYIVPAFSGLYAPYWKDD
ARGVIAGLTRYATRAHLARAALESTAYQVRDVVEAMQEDSGIRLAALKTDGGMVANELLM
QFQADILNAPVVRPKMTETTALGAAYAAGLAVGYWANLEDLRANWGVDKTWEPSMPAETR
EKYYRSWKKAVQRSFAWVD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttatgtaggggccatagaccagggcacgacgagctcgcgcttcatcgtgttt
gacaagggcgggaacatcgtttccgtcgcccagaaggagcaccggcagatctatccgaag
ccgggctgggtcgagcacgacccgatggagattctctccaacaccaacgaggtcatcggc
gccgccctcgcgcgggcaaacctcaccgcgtccgacctcgccgccgtcggcatcaccaac
cagcgcgagaccaccctgctgtgggaccgcaagaccggccagccgctctgcaacgcgctg
gtctggatggacacccgcaccgaccagctcgtccagcagttcacccgcgatggcgggcag
gaccgcttccgcgccaagaccggcctgccgctggccacctatttcgccgggctgaagctg
cgctggattctcgacaatgtcgaaggagcgaaggccaaggccgaggcgggcgacgcgctg
ttcggcaccgtcgattcctggctgacctggaacctgacgggtggcgtgaatggcggccac
cacgtgaccgacgtgaccaacgccagccgcaccatgctgatcgacctcgcgacctgcgcc
tgggatgacgacatgctgaacgcgttcggcattccgcgcgcctgcctgccgaagatcgtg
ccgtcctccgccgtctatggcgaaatccgcaccgccccgctgcaaggcacgaaactcgcc
ggcatgctgggcgaccagcaggccgccctggtcgggcagacctgcttcgcccccggcgag
gcgaagaacacctatggcaccggctcgttcctgctgatgaacaccggcaccgagcccgtg
cagtccaaggccgggctgcttaccacgctcgcctaccagctcggcgacgagaagccgcgc
tacgcgctggagggagcgatcgccatcaccggcgcgctggtgcagtggctgcgcgacaac
ctgaaactgttcgacgtcgccccgcagatcgagccgctcgcccgcagcgtcgaggacaat
ggcgatgtgtatatcgtgcccgcgttctccgggctctacgcgccctactggaaggacgac
gcccgcggcgtcatcgccgggctgacgcgctatgcgacccgcgcccacctcgcccgcgcc
gccctcgaatccaccgcctaccaggtgcgcgacgtcgtcgaggcgatgcaggaggattcc
ggcatccggctcgcggcgctgaagaccgatggcggcatggtcgccaacgaattgctgatg
cagttccaggccgacatcctgaacgccccggtggtccgcccgaaaatgaccgagaccacc
gcgctgggtgccgcctacgccgccggcctcgccgtcggctactgggcgaatcttgaggat
ctgcgcgccaactggggcgtggacaagacctgggagccgtcaatgcccgccgagacgcgc
gaaaaatactatcgctcatggaagaaggccgtgcagcgttccttcgcctgggtcgattga

DBGET integrated database retrieval system