KEGG   Acidiphilium cryptum: Acry_2395Help
Entry
Acry_2395         CDS       T00527                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
acr  Acidiphilium cryptum
Brite
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Acry_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2638307..2639386
Genome map
AA seq 359 aa AA seqDB search
MQQVINRSPLSDNAPDDDSNVAIIGVAQAVWAEMALHGIVPTPHAYEICFAYRRGDNPTL
CDFIDQHHPNLANLTPDAIESLHARFFNDSSVSEDLASNVLGLQEAADTLVGHITGNQSA
LRDYGDTLAGWAKRLDHEPTIASLVAAVAALTAETTRAAARNRALEEKLANSVQRINRLR
QSLSVARAEATTDSLTAITNRRAFDTKARRFITQTRGAAPLVACLVLFDIDNFKWFNDVH
GHQTGDLILRLVARLLSDSVKGRDTVARYGGEEFAVLLAGADLRSAISVARQICQSMADR
KLVKRSSGQQLTQVTLSAGVAQFIGGENLASWVSRADAALYRAKELGRNRVCSELDLAG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggtgatcaaccggtctcctctttctgacaacgcgcccgacgacgacagcaat
gtcgcgatcatcggcgtcgcgcaggccgtctgggccgagatggcgctgcatggcatcgtg
ccgacgccgcacgcctatgagatctgtttcgcctatcgcaggggcgacaacccgaccctt
tgcgactttatcgaccagcaccacccgaatcttgcgaacctcacgccggacgcgatcgag
tcgctgcacgcgcgcttcttcaatgactcgtccgtcagcgaggacctcgcgagcaacgtg
ctgggtctgcaggaagccgcggacacgcttgtcggccatatcaccggcaatcagtccgcg
ctcagggactatggcgacacgctcgccggctgggcgaaacgcctcgaccatgagccgacc
atcgcgagtctcgttgccgcggtcgcggcgctgacggcggaaaccacccgcgccgccgcg
cgcaaccgtgcgctcgaggaaaaactcgcgaactcggtccagcggatcaaccggctaagg
cagtccctcagcgtcgcccgggcggaagccaccaccgattccctgacggccatcaccaac
cgccgcgccttcgacaccaaggcacggcggttcatcacccagacgcgcggcgcggccccg
ctcgtcgcctgcctcgtcctgttcgatatcgacaacttcaaatggttcaacgacgtccat
ggccaccagaccggtgacctgatcctccgcctcgtcgcgcgcctgctgtccgacagcgtc
aagggccgcgacaccgtcgcccgctatggcggcgaggaattcgcggtgctgctcgccgga
gcagatctcagatcggccatttccgtggcacggcagatctgccagtcgatggccgatcgc
aaactggtcaagcgttcctcaggccagcagctgacccaggttaccctgtccgccggcgtc
gcccagttcatcggcggcgaaaacctcgcgagctgggtcagccgcgcggatgcggcactc
taccgggccaaggaactcggccgcaaccgcgtctgcagcgaactcgacctggccggctga

DBGET integrated database retrieval system