KEGG   Acidiphilium cryptum JF-5: Acry_2395Help
Entry
Acry_2395         CDS       T00527                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
acr  Acidiphilium cryptum JF-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2638307..2639386
Genome map
AA seq 359 aa AA seqDB search
MQQVINRSPLSDNAPDDDSNVAIIGVAQAVWAEMALHGIVPTPHAYEICFAYRRGDNPTL
CDFIDQHHPNLANLTPDAIESLHARFFNDSSVSEDLASNVLGLQEAADTLVGHITGNQSA
LRDYGDTLAGWAKRLDHEPTIASLVAAVAALTAETTRAAARNRALEEKLANSVQRINRLR
QSLSVARAEATTDSLTAITNRRAFDTKARRFITQTRGAAPLVACLVLFDIDNFKWFNDVH
GHQTGDLILRLVARLLSDSVKGRDTVARYGGEEFAVLLAGADLRSAISVARQICQSMADR
KLVKRSSGQQLTQVTLSAGVAQFIGGENLASWVSRADAALYRAKELGRNRVCSELDLAG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggtgatcaaccggtctcctctttctgacaacgcgcccgacgacgacagcaat
gtcgcgatcatcggcgtcgcgcaggccgtctgggccgagatggcgctgcatggcatcgtg
ccgacgccgcacgcctatgagatctgtttcgcctatcgcaggggcgacaacccgaccctt
tgcgactttatcgaccagcaccacccgaatcttgcgaacctcacgccggacgcgatcgag
tcgctgcacgcgcgcttcttcaatgactcgtccgtcagcgaggacctcgcgagcaacgtg
ctgggtctgcaggaagccgcggacacgcttgtcggccatatcaccggcaatcagtccgcg
ctcagggactatggcgacacgctcgccggctgggcgaaacgcctcgaccatgagccgacc
atcgcgagtctcgttgccgcggtcgcggcgctgacggcggaaaccacccgcgccgccgcg
cgcaaccgtgcgctcgaggaaaaactcgcgaactcggtccagcggatcaaccggctaagg
cagtccctcagcgtcgcccgggcggaagccaccaccgattccctgacggccatcaccaac
cgccgcgccttcgacaccaaggcacggcggttcatcacccagacgcgcggcgcggccccg
ctcgtcgcctgcctcgtcctgttcgatatcgacaacttcaaatggttcaacgacgtccat
ggccaccagaccggtgacctgatcctccgcctcgtcgcgcgcctgctgtccgacagcgtc
aagggccgcgacaccgtcgcccgctatggcggcgaggaattcgcggtgctgctcgccgga
gcagatctcagatcggccatttccgtggcacggcagatctgccagtcgatggccgatcgc
aaactggtcaagcgttcctcaggccagcagctgacccaggttaccctgtccgccggcgtc
gcccagttcatcggcggcgaaaacctcgcgagctgggtcagccgcgcggatgcggcactc
taccgggccaaggaactcggccgcaaccgcgtctgcagcgaactcgacctggccggctga

DBGET integrated database retrieval system