KEGG   Acidiphilium cryptum JF-5: Acry_2411Help
Entry
Acry_2411         CDS       T00527                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:acr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:acr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:acr03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:acr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2657935..2658402
Genome map
AA seq 155 aa AA seqDB search
MAQLGFYHLTRTGLEAALPALLARTLAAGARAVVRGTDPARIEALDAALWLAPGVDWLPH
GTAAMGHGPDQPVWLTTGDDVPNDARFLFLVDGATADLARFERVFDLFDGNDPDAVAAAR
ARWKAARAAGHALTYWQQGETGWIRQAEVAPETSR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctcggcttctaccacctgacgcgcaccgggctggaggccgccctgcccgcc
ctgctcgcccgcaccctcgccgccggcgcgcgggcggtggtgcgcggcaccgatcccgcc
cggatcgaggcgctggacgccgccctctggctcgcgccgggggtggactggctgccgcac
ggcaccgccgcgatgggtcatggccccgaccagccggtctggctcaccaccggcgacgac
gtgccgaacgacgcgcggttcctgttcctggtggatggcgcgacggcggatctcgcccgc
ttcgagcgggtgttcgacctgttcgacggcaacgaccccgatgcggtggccgccgcgcgc
gcccgctggaaggccgcgcgcgccgccggccacgcgctgacctactggcagcagggcgag
accggctggatcaggcaggcggaagtcgcgccggaaacctcgcgttaa

DBGET integrated database retrieval system