KEGG   Acidiphilium cryptum JF-5: Acry_2557Help
Entry
Acry_2557         CDS       T00527                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:acr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2810586..2811761
Genome map
AA seq 391 aa AA seqDB search
MAVKTVTILGSTGSVGTQTIDLLQADPENYRVRALIAGRNAALLAEQARSLHAEIAVIAD
ESAFPALRDALAGSGIRAEAGRAAVIAAAAEPADWTMAAITGTAGLEPTLAATRNGGAIA
LANKEALVSAGDVFLAAIAAGGATLLPVDSEHNAIFQSLADGNRAALEKIILTASGGPFR
EASLDEMKDATPETALKHPVWSMGAKISIDSATLFNKGLEVIEAARIFGLAPHEIEVLVH
PQSIVHGMVCYRDGSVLAQMGAPDMRIPIAHTLAWPARLATSSPRLDLAAAARLDFLAPD
PVRFPALRLAREALEAGHGASTVLNAANEIAVEAFLRRRIGFLDITAVVERVMQRLGAPP
IGDLAAVLALDAEARAMAEAELRAKSDPRAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaagacagtcacgatcctcggctcgaccggcagcgtcggcacccagaccatc
gacctgctgcaggcggatcccgaaaactatcgggtccgtgcgctgatcgccgggcgaaac
gccgccctgctcgcggaacaggcgcgctcgctgcacgccgagatcgccgtcattgctgac
gagagcgccttccccgccctgcgcgacgcgctggccggcagcggcatccgcgccgaggcc
ggccgcgccgccgtgatcgccgccgccgccgagccggccgactggacgatggccgcgatc
accggcaccgccggcctcgaacccacactcgccgcgacccgcaacggtggggccatcgcg
ctcgccaacaaggaggcgctggtttccgccggcgacgtgttccttgccgcgatcgccgcc
ggcggagcgacgctgctgccggtcgattccgaacacaacgccatcttccagtcgctcgcc
gacggcaaccgcgccgctctggaaaagatcatcctcaccgcttcgggcggcccgttccgg
gaagcaagcctcgacgagatgaaggacgcgacgccggagaccgcgctgaagcatcccgtc
tggtcgatgggtgcgaagatctcgatcgattccgccaccctcttcaacaaggggctggag
gtgatcgaggccgcgcgcatcttcggcctcgcgccgcatgagatcgaggtgctggtgcat
ccgcagtcgatcgtgcatggcatggtctgctatcgcgacggatcggtgctggcccagatg
ggcgcgccggacatgcgcatcccgatcgcccacaccctggcctggccggcgcgcctcgcg
acctcctcgccccggctcgacctcgccgccgcggcgcggctcgacttccttgcccccgat
ccggtgcgcttcccggcgctccgtcttgcgcgcgaggcactggaagccggccatggcgcc
tcgacggtgctcaacgccgcgaatgagatcgcggttgaggcgttcctgcgccggcggatc
ggctttctcgacatcacggcggtggtcgaacgggtcatgcagcgcctcggcgcgcccccg
atcggcgatctcgcggccgtgcttgccctcgatgccgaagcgcgcgccatggcggaggcg
gaattgcgcgcgaagtccgacccgcgcgcggcgtga

DBGET integrated database retrieval system