KEGG   Acidiphilium cryptum JF-5: Acry_2573Help
Entry
Acry_2573         CDS       T00527                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:acr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2828205..2828873
Genome map
AA seq 222 aa AA seqDB search
MSDLDLRKALISACQQMNALGINQGTSGNISVRHGDTMLISPSATPYHLIEPDMIAAMPI
EGEYGAWTGKLKPSTEWRFHLDIMRARPEVNAIVHSHPTFATTLAIARRDIEACHYMVAA
FGGVDVRCAPYATFGTKELSVHALKALEGRMGCLLANHGMIVLGENLDKAMWRAVELETI
SRQYYHALVLGKPHILSAADIDATLAQFSGYGLQDDAGADAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcgaccttcgcaaggccctgatctccgcctgccagcagatgaacgcgctg
ggcatcaaccagggcacgtccggcaacatcagcgtccgccacggcgacacgatgctgatc
tcgccctccgccacgccctatcacctgatcgagcccgacatgatcgccgccatgccgatc
gagggcgaatacggcgcctggacgggcaagctgaaaccttcgaccgaatggcgcttccat
ctcgacatcatgcgcgcccggcctgaagtgaacgcgatcgtccacagccaccccaccttc
gcgaccacgctcgccatcgcccggcgggacatcgaggcctgccactacatggtcgcggcc
tttggcggggtcgatgtgcgttgcgcgccctatgccacgttcggcaccaaggagctttcg
gtgcatgcgctgaaggcgctggaaggacgcatgggctgcctgctcgccaatcacggcatg
atcgtgctcggcgaaaatctcgacaaggcgatgtggcgcgcggtcgagctcgaaaccatt
tcgcggcagtattaccacgcgctcgtgcttggcaagccgcacatcctcagcgccgccgac
atcgacgcaacgctggcccagttctccggctacggcctgcaggatgacgccggagccgat
gccgcatga

DBGET integrated database retrieval system