KEGG   Acidiphilium cryptum: Acry_2641Help
Entry
Acry_2641         CDS       T00527                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
acr  Acidiphilium cryptum
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acry_2641
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Acry_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2896379..2897422
Genome map
AA seq 347 aa AA seqDB search
MKAAVLHGYDEKLTAPDFVTYEDVPEPQIRNPTDVIVRIGGAGVCRTDLHIIEGVWRSKV
DLKFPHIMGHENAGWIEEVGSAVTHLKKGDPVICHPLITSGHCLACRRGDDMHAEESEFP
GINCNGGYAELLRTGARSIIKLPKSLAPKDVAPHTDAGLTAYRAAKKASRHLLPGQFAVV
IGAGGLGHIGIQVLRAMCAARIIIVDRADMALQLAQECGADFAVKADGSELDEVMRLTGG
KGAEAVIDFVGEGDAVAKGLAMTRDGGYYYIVGYGGKIDIPTIDMITSEKTIVGNLVGTY
PELIELMALADQGKVTLATREYRLDEANAALHDLHHGKVRGRAVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtgctgcacggatacgacgaaaagctcaccgcacccgacttcgtcacc
tacgaggacgtgcccgaaccgcagatccgcaacccgaccgacgtcatcgtccgcatcggc
ggcgccggcgtctgccggaccgacctgcacatcatcgagggcgtctggcgctcgaaggtc
gatctcaagttcccgcacatcatgggccacgagaacgccggctggatcgaggaggtcggt
tccgccgtcacccacctgaagaagggcgacccggtgatctgccatccgctgatcacctcc
ggccactgcctcgcctgccgccgtggcgacgacatgcacgccgaggaaagcgaattcccc
ggcatcaactgcaatggcggctatgccgagctgctgcgcaccggcgcgcgctcgatcatc
aagctgccgaaatcgctcgcgccgaaggacgtcgccccgcataccgatgccgggctcacc
gcctaccgcgccgcgaagaaggcctcgcgccacctgctgcccggccagttcgcggtggtg
atcggcgccggcggcctcggccatatcggcatccaggtgctgcgcgcgatgtgcgccgcc
cggatcatcatcgtcgaccgcgccgacatggcgctgcagctcgcccaggaatgcggcgcc
gatttcgcggtgaaggcggacggctccgagctcgacgaggtgatgcgcctgaccggcggc
aagggcgccgaggcggtgatcgacttcgtcggcgagggcgacgccgtggcgaaaggcctc
gcgatgacgcgcgacggcggctactattacatcgtcggctatggcgggaagatcgacatc
cccaccatcgacatgatcacctcggaaaagaccatcgtcggcaatctcgtcggcacctat
cccgagctgatcgagctgatggcgctggccgaccagggcaaggtcaccctcgccacccgc
gaataccggctggacgaggccaatgccgccctgcacgacctgcatcacggcaaggtccgc
ggccgcgccgtgctgattccctga

DBGET integrated database retrieval system