KEGG   Acidiphilium cryptum: Acry_2663Help
Entry
Acry_2663         CDS       T00527                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acr  Acidiphilium cryptum
Pathway
acr00900  Terpenoid backbone biosynthesis
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acry_2663
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Acry_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABQ31854
UniProt: A5G1X2
Position
2922857..2923735
Genome map
AA seq 292 aa AA seqDB search
MTDASPGFACAPGFACAKVNLHLHVTGRRADGYHLLDSLVVFPPVGDTLSLAPAAGLSLA
VDGPFAPALSGEGDNLVLRAAARFAAHAGRAPEAAFRLVKTLPVASGIGGGSADAAAALR
LLAARWNLPIPPDLALALGADVPVCLARRPARMSGIGEILAPAPALPQFGLVLVNPGVAV
STPAIFRARAGEFSPQADLPSAWPTAGRMAADLARLGNDLQAPAIALAPVIADVLAAIAA
AESCLLARMSGSGATCFGLFPDAAAARRAAAGLARDGWWCWGGAGQMAPAQG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcttcccccggcttcgcctgcgcgcccggcttcgcctgcgcgaaggtgaac
ctccatctgcacgtcaccggccgccgcgccgatggctaccacctgctcgacagcctggtg
gtcttcccgcccgtgggcgacacgctgtcgctcgcccccgccgccggcctgtccctcgcc
gtcgacggcccttttgcgccggcgctgtcgggcgagggggacaatctcgtcctccgcgcc
gccgcccgcttcgccgcccatgccggccgcgcgccggaggccgccttccgcctcgtcaag
accctgcccgtcgcctccggcatcggcggcggctcggcggatgccgcggcggcgctgcgc
ctgctcgcggcgcgctggaaccttcccatcccgcccgatctcgccctcgccctcggcgcc
gacgtcccggtctgcctcgcccgccgcccggcgcggatgtccggcatcggcgaaatcctc
gcccccgcgcccgccctgccgcaattcggcctcgtgctggtcaatcccggcgtcgcggtc
tccaccccggcgatcttccgcgcccgcgccggcgaattttccccgcaagccgacctgccc
tcggcctggccgaccgccgggcgcatggccgccgacctcgcccgcctcggcaacgacctg
caagcccccgccatcgccctcgcccccgtcatcgccgatgtcctcgccgcgatcgcggcc
gccgagtcctgcctgctggcgcggatgagcggctcgggggccacctgtttcggcctgttc
cccgatgccgccgccgcccgccgcgccgccgccggcctcgcccgcgacggctggtggtgc
tggggcggggccgggcagatggcgccggcgcagggctga

DBGET integrated database retrieval system