KEGG   Acidiphilium cryptum: Acry_2663Help
Entry
Acry_2663         CDS       T00527                                 

Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acr  Acidiphilium cryptum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acry_2663
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Acry_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2922857..2923735
Genome map
AA seq 292 aa AA seqDB search
MTDASPGFACAPGFACAKVNLHLHVTGRRADGYHLLDSLVVFPPVGDTLSLAPAAGLSLA
VDGPFAPALSGEGDNLVLRAAARFAAHAGRAPEAAFRLVKTLPVASGIGGGSADAAAALR
LLAARWNLPIPPDLALALGADVPVCLARRPARMSGIGEILAPAPALPQFGLVLVNPGVAV
STPAIFRARAGEFSPQADLPSAWPTAGRMAADLARLGNDLQAPAIALAPVIADVLAAIAA
AESCLLARMSGSGATCFGLFPDAAAARRAAAGLARDGWWCWGGAGQMAPAQG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcttcccccggcttcgcctgcgcgcccggcttcgcctgcgcgaaggtgaac
ctccatctgcacgtcaccggccgccgcgccgatggctaccacctgctcgacagcctggtg
gtcttcccgcccgtgggcgacacgctgtcgctcgcccccgccgccggcctgtccctcgcc
gtcgacggcccttttgcgccggcgctgtcgggcgagggggacaatctcgtcctccgcgcc
gccgcccgcttcgccgcccatgccggccgcgcgccggaggccgccttccgcctcgtcaag
accctgcccgtcgcctccggcatcggcggcggctcggcggatgccgcggcggcgctgcgc
ctgctcgcggcgcgctggaaccttcccatcccgcccgatctcgccctcgccctcggcgcc
gacgtcccggtctgcctcgcccgccgcccggcgcggatgtccggcatcggcgaaatcctc
gcccccgcgcccgccctgccgcaattcggcctcgtgctggtcaatcccggcgtcgcggtc
tccaccccggcgatcttccgcgcccgcgccggcgaattttccccgcaagccgacctgccc
tcggcctggccgaccgccgggcgcatggccgccgacctcgcccgcctcggcaacgacctg
caagcccccgccatcgccctcgcccccgtcatcgccgatgtcctcgccgcgatcgcggcc
gccgagtcctgcctgctggcgcggatgagcggctcgggggccacctgtttcggcctgttc
cccgatgccgccgccgcccgccgcgccgccgccggcctcgcccgcgacggctggtggtgc
tggggcggggccgggcagatggcgccggcgcagggctga

DBGET integrated database retrieval system