KEGG   Acidiphilium cryptum: Acry_2827Help
Entry
Acry_2827         CDS       T00527                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
acr  Acidiphilium cryptum
Brite
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Acry_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3093889..3095022)
Genome map
AA seq 377 aa AA seqDB search
MRRQYLVHAPIRRKMIALYAVLITGAIMAGLQAASAAPPGGEFPSKVPVPADNPMTPRKI
HLGKQLYFDPRLSLSGDVSCDTCHNVAGNGSDGLPLSFGVLGRVDRPRHAPTVFNSAFNT
VQFWDGRAKSLEDQAKGPLLNPIEMGMPSSGAIVKRLAGIPGYRREFARVFGGKTPITFE
HVVQAIATYERTLVTPDSPYDRYLKGDKNALDKSAKQGMHEVSDLGCASCHAGAMFDNPG
LPMGTGWFRKFPMIPTNPTCATYVREYHLADDPGRFDVTHKQSDEHVFKVPSLRNVAVLA
PYFQNGSVGSLRTAVRVMAACQLGKTLTGLQTTNIVAFLNSLTGKFPVETMPRLPETPDS
TSLMQVAKLQQNRRQLN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagacgacaatatcttgtccatgcgccgatcaggcgcaaaatgatcgcgctctacgcc
gttctgatcaccggcgcgattatggcgggactgcaagcggcctcggccgctccccccggc
ggcgagtttccatcgaaggtgccggttcccgccgacaacccgatgaccccccggaagatc
catcttggcaagcagttgtatttcgatccgcggctgtcattgtcgggcgacgtgtcctgc
gacacctgccacaacgtcgcgggaaatggcagcgatggactgccgctctccttcggtgtt
ctgggccgcgtcgaccggccaagacacgcgccgaccgtgttcaattccgcgttcaatacg
gtccagttctgggacggacgcgcaaagagccttgaagatcaggcgaaggggccattgctc
aatccgatcgagatgggcatgccgagttccggagccatcgtgaagcgcctggctgggatt
cccggttacaggcgggaatttgcccgtgttttcggcggcaagacgccgatcaccttcgaa
cacgtcgttcaggcgatcgccacatacgaacggaccctggtgacgcccgacagcccatac
gatcggtatctgaagggcgacaagaacgcgctcgacaagtcggcgaagcagggaatgcac
gaggtctccgatctcggctgtgcgagctgccacgccggcgcgatgttcgataatccgggc
ctgcccatgggaaccggttggttcaggaaattccccatgatcccgacaaacccgacctgc
gccacctatgtgcgggagtaccatctcgccgacgatcccggacggtttgacgtcacgcac
aagcaaagcgacgagcacgtcttcaaggttccgagcctgcgcaacgtcgccgtccttgcg
ccatatttccagaacgggtccgtggggtcgctgcgaaccgccgttcgggtgatggccgca
tgtcagttgggcaagacgctgaccgggctgcagacgacgaacatcgtcgcgttcctaaac
agcctgaccggaaagtttccggtcgagaccatgccacgcctgccggaaacacccgacagc
acatcactgatgcaggttgccaagctccagcaaaatcggcgccagctcaactga

DBGET integrated database retrieval system