KEGG   Acidiphilium cryptum: Acry_2877Help
Entry
Acry_2877         CDS       T00527                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acr  Acidiphilium cryptum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acry_2877
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Acry_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3143229..3144131)
Genome map
AA seq 300 aa AA seqDB search
MLVVGSANMDLVVRTRRAPDAGETVMGLDYATYPGGKGANQAVAARRAGATVAFATCLGR
DAHGDALHATLAAEGIDLSLLRRVDAASGVALITVEHGGQNRIVVVPGANQDLRPERLPD
PVPAGLLLAQLEVPVETVLAAARRMRAAGGRTVLNASPVDRLDPATRADLLAETDILVVN
ETEAAALLGADSPDAAPAEMAHRLAAGRQAAIVTLGAAGVVWHAGKAGSRVEPHRVPVVD
TTACGDAFAGALAASLEAGGSIEEAVRFGNAAGALAATRTGAQPSLPTRQAILDLLTRDT
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgtcggcagcgcgaatatggatctcgtggtgcggacacggcgcgccccggat
gcgggcgaaaccgtcatgggcctcgattacgcgacttatccgggcggcaagggggcgaac
caggcagtcgccgcgcggcgggcgggcgcaacggtcgccttcgccacctgcctcggccgc
gacgcccatggcgatgccctccacgcgacgctcgccgcggaaggcatcgatctctccctt
ctgcgccgcgtcgacgcggcgagcggggtcgcgctcatcaccgtggagcacggcgggcag
aaccgcatcgtcgtcgttccgggcgcgaaccaggatctgcggccggagcgcctgcccgat
ccggtgccggcagggctgctgctggcccagctggaggtgcccgtggaaaccgttctggcg
gcggcgcgacgaatgagggccgctggcgggcggacggtgctcaacgcctcgccggtggac
cggctcgatccggccacgcgggccgatctcctggctgaaaccgacattctcgtggtcaac
gaaaccgaagcggccgccctcctgggcgccgattctccggatgccgcaccggccgagatg
gcccaccgccttgccgccggacggcaggcggccattgtcaccctcggcgccgctggcgtg
gtatggcacgcgggcaaggcgggtagccgggttgagccgcatcgggttccggtggtcgat
accaccgcctgcggcgacgccttcgccggcgcgctggctgcctcgctcgaggcgggcggc
tcgatcgaggaggctgtccgtttcggcaatgcggccggcgcgctggccgcgacacggacc
ggcgcgcagccctccctgccgacccgccaggccattctcgacctgctgacccgcgacaca
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system