KEGG   Acidiphilium cryptum: Acry_2936Help
Entry
Acry_2936         CDS       T00527                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acr  Acidiphilium cryptum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acry_2936
Enzymes [BR:acr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Acry_2936
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acry_2936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3205366..3207531
Genome map
AA seq 721 aa AA seqDB search
MPASADETLDALAAGTHADPFSVLGPCHGPLGTFVRTLQPGASGVTLLCGTGLELPMTRV
HAGGIFESAPVEATSYRLRIDWGGSSQEIDDPYRYGPLLGRDEIRDLAEGRKLRLAECLG
AIPVAIGGVEGVRFAVWAPNARRVSVIGSFNGWDGRRHPMRFRHDAGVWEIFIPELSAGT
LYKYEILQHSGEVQQKSDPVARQVEGPPATASIVAPVPAFRWRDGAWCAAREARSDKPLS
IYEVHAPSWRRHPDGRPLLWRELADTLIPYVRDLGFTHIEFLPLTAHPFGGSWGYQPLSQ
FAPLPALGTPEELADFVDRCHAAGLGVILDWVPGHFPTDAHGLVRFDGTALYEHEDPREG
FHQDWNTLIYNLGRTEVRNFLIASAVFWLETFHIDGLRVDAVASMLYRDYSRQPGEWIPN
RHGGRENLEAVAFLRELSAAIAENVPGAMLIAEESTAWPGVSHPVEQGGLGFTHKWNMGW
MHDTLRYVGHDPVHRKFSHHDMTFGLVYAFSERFVLPISHDEVVHGKRSLLGKMPGDAWQ
RLANLRLYLAFMWTQPGKKLLFMGQEFGQSAEWNHDAELNWPEAATPEHAALRLLLRDLN
HLYRDTPSLSCTDFDPDGFRWVVEDDADQSVFAWLRHVGNDPNALLVLCNFTPVPRERYR
VGVPLPGRWREVLNTDAVEYGGSGLGNLGGIDSDDRPAHGFAQSLSLTLPPLAALILRAE
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgccggcatcggctgacgaaacgctggacgcgcttgcggccggaacccatgccgacccg
ttcagcgtgcttggtccctgccatgggccgctcggaacgttcgtccggaccctccagccc
ggcgcgagcggcgtcacgctcctgtgcggcacgggtctggaactgccgatgacccgcgtg
catgcgggcggcattttcgaaagcgcgccggtcgaggccacgtcgtaccggctcaggatc
gattggggtggttccagccaggagatcgacgatccctaccgctacggcccgctgctcggc
cgcgacgaaatccgcgatctcgccgaggggcggaaactgcggctcgccgaatgcctcggc
gccatccccgtcgcgatcgggggcgtcgagggcgtccgcttcgcggtctgggcgccgaac
gcgcggcgggtttccgttatcgggtcgttcaacggctgggatggccgccggcacccgatg
cggttccggcacgatgccggcgtctgggagatcttcattccggaactttccgccggaact
ctctacaagtatgaaattctccagcactcgggcgaagtccagcagaaatcggaccccgtc
gcgcggcaggtcgagggcccgccggcaaccgcctccatcgtcgcgccggtcccggcgttt
cgctggcgggatggcgcctggtgtgccgcgcgcgaagcccgttctgacaagccgttatcc
atctacgaagtccacgccccctcgtggcgccgtcacccggatggccgccccttgctctgg
cgcgaactggccgacacgctgatcccctatgtgcgcgatctcggctttacccatatcgaa
ttcctgccgctcacggcgcaccctttcggcgggtcgtgggggtaccagccgctgtcgcaa
ttcgcgccgctccccgccctcggcacgccggaagagctggcggacttcgtcgatcgctgt
catgcggcaggtctcggagtcattctcgactgggtgcccggacattttccgaccgatgcc
cacgggctcgtccggttcgacggaaccgcgctctatgaacacgaagatcccagagaggga
ttccatcaggactggaatacgctgatctacaatctcggccggaccgaagtcaggaatttc
ctgattgccagcgcggtgttctggctcgagacatttcacatcgatggactccgcgtcgat
gcggtcgcgtcgatgctgtatcgcgactattcgcgccagcccggcgagtggatcccgaac
cgccatggcgggcgggagaacctcgaagccgtcgccttcctccgggagctttctgccgcc
atcgctgaaaatgttcccggcgccatgctgatcgccgaggaatcgacggcgtggccgggg
gtgagccatccggtcgaacagggcggtctcggcttcacccacaagtggaacatgggctgg
atgcacgacacgttgcggtatgtcggacatgatccggtgcatcggaaattctcccaccac
gacatgacctttggcctcgtttacgcgttttccgagcgcttcgtgctgccgatctcgcac
gacgaggtcgtgcacggaaagcggtcgctgctcggcaagatgcccggcgacgcctggcag
cgtctggccaacctccggctctacctcgccttcatgtggacccagcctggcaagaagctg
ttgttcatggggcaggaattcggccagagtgcggaatggaatcacgatgccgaattgaac
tggccggaggcggcaacgccggaacacgcggccctgcgcctgctgttgcgcgacctgaac
catctctatcgcgacacgccctcgctgtcgtgcacggatttcgatccggatggcttccgc
tgggtggtcgaggatgacgcggatcaaagcgtctttgcctggctgcggcatgtgggaaat
gacccaaacgccctcctggtcctctgcaacttcacgccggtgccgcgtgagcgataccgt
gtgggcgtgccgctgccggggcgctggcgcgaggtgctgaacaccgacgccgtcgagtat
ggcggcagcggcctcggcaatctcggcgggatcgacagtgacgatcgccccgcccacgga
ttcgcgcagtcgctgtcgctgacattgccgccgctggcagcgctgatcctgcgtgcggag
agctga

DBGET integrated database retrieval system