KEGG   Acidiphilium cryptum: Acry_2938Help
Entry
Acry_2938         CDS       T00527                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
acr  Acidiphilium cryptum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acry_2938
Enzymes [BR:acr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Acry_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3209639..3211633
Genome map
AA seq 664 aa AA seqDB search
MSGSALHALAERAGLQVVWQDASGVRRTVSPATLRAILGCLGLEASTDAACRDTMRRLDD
EDRAAAPLLAATAGEALTLPALRGPAVIHLEDGRRLDVTPGTAAGGNATLPATLPPGYHR
LETASGVRTLAIAPRRAHTVADALAAAGREGKAWGLAVQLYGLRREGDCGNGDFAALADL
AGPAGRLGADALAISPIHALHAAEPDHYSPYAPSSRFALNPAYAPLDCAPLAEAGLIDWR
KALSRREALLRAAFAAGRADPAFRAFRDDAPAGIRHYALFEALVAERVARGDGRDWRGWP
ASWRDPASADVAAAAQRLDDEVSFHLYAQFRARQGLEMAQRSARGAGMAIGLIADLAVGA
DPAGCDAWARPGEMLRGVSVGAPPDAFNRAGQNWGLTTVSPRGLRRSGFAALRDMMASAL
RFTGGVRIDHAMGLARLWLVPDGASPAEGCYLHYPFADMRRIVALESVRHRGIIVAEDLG
TVPPGFRAELAASGISGMAVMWFEREGRRFLPPADWRPNSVAMTTTHDLPTVAGWWRGTD
LGWRERLGIAGESAADRAEDRRHLWSALRQSGCARGPRPQDREPEAVIDATVAHIGTASS
ELALLPLEDALGLPDQPNLPGTTTEHPNWRRRMPQPASRMLDPPEVTARLSRLARARKNT
PPPR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcggcattgcacgcgctcgccgagcgggcgggcctgcaggtggtctggcag
gacgcgtcgggcgtccggcgcacggtctcgccggccacgcttcgcgcgatcctcggctgc
ctcggcctcgaagcgagcaccgacgcggcgtgccgcgacaccatgcgccggctcgacgac
gaggaccgcgcggccgcgcccctgctcgccgcgaccgcgggcgaagcgctgacgcttccg
gcactccgcggcccggcggtcatccatctcgaggacgggcgtcggctcgatgtcacgccc
ggcacggctgccggcgggaacgccacgctgcccgccaccctgccgccgggctatcaccgt
ctggagacggcctcaggcgtccgcacgctcgccatcgcgccgcggcgcgcccacaccgtg
gccgacgcgctcgccgccgccggacgggagggcaaggcgtggggacttgccgtccagctc
tacggcctgagacgcgagggcgattgcggcaacggcgatttcgccgccctggccgatctt
gccgggccggccggccgcctcggcgccgatgccctggcgatcagccccattcacgccctg
cacgccgccgagcccgatcattacagcccctatgcgccatcgagccgcttcgccctgaac
ccggcctatgcgcccctcgattgcgcgccgctggcggaggccgggctgatcgactggcgc
aaggcgctctcccgccgcgaggcgctgctgcgcgcggcgttcgccgccgggcgcgcggat
ccggcattccgcgccttccgcgacgatgcgccggcgggaatcaggcattacgcactgttc
gaagccctcgtcgccgaacgcgtcgcccgcggcgacgggcgggactggcgcggctggccc
gcctcgtggcgcgatccggccagcgccgatgtcgccgcggcggcccaacgcctcgacgat
gaggtgtcgttccacctttacgcccagttccgcgcccgccagggcctggagatggcccag
cgctccgcgcgcggcgccggcatggcgatcggcctcatcgccgaccttgcggtcggcgcc
gatcccgccggctgcgatgcctgggcgcggccgggcgagatgctgcgcggcgtctcggtc
ggcgcgccgccggatgcgttcaaccgtgcgggacagaactggggcctgaccaccgtctcg
ccgcgcggcctgcgtcggtcgggcttcgccgccctgcgggacatgatggcatcggcgctg
cgcttcaccggcggcgtgcggatcgaccatgcgatgggcctcgcccggctgtggctcgtc
cccgacggcgccagccccgccgaagggtgctaccttcactatccgttcgcggacatgcgc
cggatcgtggcgctggaatcggtccgccaccgcggcatcatcgtggccgaggatctcggc
accgttccgccaggcttccgcgccgagctcgccgcctccggaatttcagggatggcggtg
atgtggttcgaacgcgagggccgccgcttcctgcccccggccgactggcgccccaattcg
gtggcgatgaccacgacgcacgacctgccgaccgtcgccggctggtggcgcggcaccgac
ctcggctggcgggagcggctcggcatcgccggcgaaagcgccgcagatcgggcggaggac
cgccgtcacctgtggtccgccctccggcaatccggttgcgcccgcgggccgcggccgcag
gatcgggagcccgaagcggtcatcgacgccacggtggcccatatcggcacggcctcatcc
gagcttgcgcttcttcccctggaggatgcgctcggactgccggaccagcccaatctcccc
ggcacgaccaccgaacatccgaactggcgacggcgaatgccgcaaccggccagccgcatg
ctcgacccgcccgaggtcaccgcccggctgtcacggcttgcccgcgcgcgaaaaaacacg
ccgccaccaaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system