KEGG   Acidiphilium cryptum: Acry_3069Help
Entry
Acry_3069         CDS       T00527                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K11907  
type VI secretion system protein VasG
Organism
acr  Acidiphilium cryptum
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acr00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Acry_3069
Secretion system [BR:acr02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   Acry_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3348860..3351508)
Genome map
AA seq 882 aa AA seqDB search
MAAIDLKSLIARLDDHCRRSLEAAAGLTLSRSHYNVEIEHWLLKLADGTDTDIPLILRHY
EIDIGRFLIDLNRALDRMKTGNARAPALSPEVVELAKQAWLLASVEHGLSRTRSGHLLWA
LLADETLARHAREASSHFAKIQPDALKRDFNAITANSIEAQTATRATDGAPAAGGTDDGT
PRPGGSAALDQFTEDLTARARAGRIDPILGRDFEIRQAIDILTRRRQNNPIFTGEAGVGK
TAVVEGIALKIAQGDVPEALKNVTLRTLDMALLQAGAGMKGEFENRLKSVIDEVKASPKP
IILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFERDAALTRR
FQVVKVEEPSEAMATAMIRGLVGTLEKHHKVRILDEAVSEAVRLSARYIPSRQLPDKAIS
LIDTACARVGMSQATEPAPIEDRRRRIDLIDTETGILRREMASGGDHAAREAELIEERAR
LVAELAELEARFTTEKQLAGDIAELRTRLEDDANAEDKDALRASLAEKTAALKASQGENP
LIFPVVDGQAVAEIVESWTGIPAGRMQSDEINTVLKLKEAMEQRIVGQPHALEAVAQAIR
TSRAKLTDPRKPIGVFMMVGTSGTGKTETALTLANLLYGGEQNMTTINMTEFKEEHKVSL
LMGSPPGYVGYGEGGVLTEAVRRRPYSVVLLDEMEKAHPGVQDVFFQVFDKGNMKDGEGR
DIDFKNTIIIMTSNAGTDLIEKLFADPETAPDAAALAEALRPELLKYFKPAFLGRVTIVP
YFPLSDEVIRQIVVLQLNKIAKRVREGYKAEFTYEPALVETIAARCKESASGARNVENIL
SRTLLPELSAEVLARLAEGEMISRVTVGTSEDGMFRYTINQA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatcgatctcaaatctctgatcgcccgcctcgacgaccactgccgccgcagc
ctcgaggccgcagccggcctaacgctgtcgcgaagccattacaacgtcgaaatcgaacat
tggctgctcaagctcgccgatggcaccgacaccgacattccgcttattcttcgacattac
gagatcgatatcggtcgtttcttgatcgatctcaaccgcgcgctcgaccggatgaagacc
ggcaacgcccgcgccccggccctgtcaccggaagtcgtcgagctcgcgaaacaggcctgg
ctgctggcatcggtcgaacacgggctgagccgcacgcgctcgggtcacctgctttgggcc
ctgctggccgacgagaccctggcccgccacgcccgcgaggcctccagccatttcgcaaaa
atccagccggacgcactgaagcgcgacttcaacgccatcaccgccaattccatcgaggcg
cagaccgcgacccgcgcgaccgatggcgcgccggctgcgggcggcaccgatgacggcacg
ccccgtcccggcggctcggcggcgctggaccagttcaccgaagatctgaccgcccgcgcg
cgcgccggccggatcgacccgatcctcggccgcgacttcgaaatccgccaggcgatcgac
atcctcacccgccgccggcagaacaacccgatcttcaccggcgaggcaggtgtgggcaag
accgcggtggtcgagggcatcgcgctgaagatcgcccagggcgacgtgccggaggcgctg
aagaacgtcacgctgcgcacgctcgacatggcgctgctccaggccggggcgggcatgaag
ggcgagttcgagaaccggctgaaatcggtgatcgacgaggtgaaggcctcgccgaagccg
atcatcctgttcatcgacgaggcgcacacgctgatcggcgccggcggccaggccggccag
aacgacgcggcgaacctgctcaagcccgccctcgcccgcggcgagctgcgcaccatcgcg
gcgacgacctgggccgaatacaagaaatatttcgagcgcgacgccgccctgacccgccgc
ttccaggtggtcaaggtcgaggagccgtccgaggcgatggccaccgcgatgatccgcggc
ctcgtcggcacgctcgagaagcaccacaaggtccgcatcctcgacgaggcggtgagcgag
gccgtcaggctgtcggcgcgttatattccctcacgccagctgccggacaaggcgatctcg
ctgatcgacacggcctgcgcccgcgttggcatgagccaggcgaccgaacccgccccgatc
gaggatcgccgccgccggatcgacctgatcgacaccgaaaccggcatcctccgccgtgag
atggccagcggcggcgatcacgccgcccgcgaggccgaactgatcgaggagcgtgcgcgg
ctggtcgccgaactcgccgagctcgaggcccgcttcacgaccgagaagcagctcgccggc
gatatcgccgagctgcgcacccggctggaagacgacgcgaacgcggaggacaaggacgcg
ctgcgcgccagcctcgccgaaaagaccgcggcgctgaaggcctcgcagggcgagaacccg
ctgatcttcccggtggtcgacggccaggccgtcgccgagatcgtcgagagctggaccggc
attcccgccgggcgcatgcagtccgacgagatcaacacggtgctgaagctgaaggaggcg
atggagcagcgcatcgtcggccagccccatgcgctcgaggcggtcgcccaggcgatccgc
acctcgcgcgcgaaactcaccgacccgcgcaagccgatcggcgtcttcatgatggtcggc
acctccggcaccggcaagaccgaaacggcgcttaccctcgccaacctgctctatggcggc
gagcagaacatgaccaccatcaacatgaccgagttcaaggaagaacataaggtcagcctg
ctgatgggcagcccgcccggctatgtcggctatggcgagggcggcgtgctgaccgaggcg
gtgcgccggcgcccctattcggtggtgctgctcgacgagatggaaaaggcccatcccggc
gtgcaggacgtcttcttccaggtgttcgacaagggcaacatgaaggacggcgaaggccgc
gacatcgacttcaagaacaccatcatcatcatgacgtcgaatgccggcaccgacctgatc
gagaaactcttcgccgatcccgaaaccgcgccggacgccgccgccctcgccgaagcgctg
cggccggagctgctgaaatatttcaagcccgcctttctcggccgcgtcaccatcgtcccc
tatttcccgctctccgacgaggtgatccgccagatcgtggtgctccagctcaacaagatc
gcgaagcgcgtgcgcgagggctacaaggccgaattcacctacgagcccgcgctcgtcgaa
accattgccgcacgctgcaaggaatcggcctcgggcgcgcgcaacgtggaaaacatcctc
tcccgcacgctgctgcccgaactctcggccgaggttctggccaggcttgccgaaggcgag
atgatttcccgcgtgacggtgggcacatccgaagacgggatgttccgctacaccatcaat
caggcttaa

DBGET integrated database retrieval system