KEGG   Acidiphilium cryptum JF-5: Acry_3273Help
Entry
Acry_3273         CDS       T00527                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pACRY01:182886..185081
Genome map
AA seq 731 aa AA seqDB search
MASRPADTAPAQAPDREVLAGLVERVTFHNAENGFCVLRVKARGHRDLVTVIGHAATISA
GEWLTASGEWVNDRVHGQQFRSKFLRTSAPTTAEGIERYLASGMIRGIGPVYAKKLIRAF
GDTVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIMVFLHSHGVSTARAVWIF
KTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARDAMIRVRAGIGHALATAMD
DGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIADQVAGTDCVFLAGLYRAEQ
GIAERLRIIASGATSWPSIDADKAIGWVESHLGMNLAASQSEAVRLALTAKLLVITGGPG
VGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTGFEAKTIHRLLEVDPASGGFRR
GVDHSLECDLLVIDETSMVDVPLMHALTRAIPDEAALLVVGDVDQLPSVGPGQVLADLIG
SGAVPVVRLTEIFRQAAASRIITVAHSVNRGEIPDLGRADPESDFHFVAADEPETAVERI
VELVKTRIPRRFRLDPIRDIQVLCPMARGGVGARSLNITLQAALNGAAEPRVERFGWTYA
PGDKVMQIENDYDREVYNGDIGFIARVDAEAGEIAVGFDGREVVYGLGELDALVPAYAAT
IHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGITRGRRLVVLVGSRRAVAIAVRNISGRR
RWSKLREWLGQ
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccgccccgcagacactgcccctgcccaagcaccggatcgcgaggtcctcgcc
ggcctggttgagcgggtgacgttccacaatgccgagaacggtttctgcgtgttgcgggtg
aaagcccgggggcaccgtgatctcgttacagtcatcgggcatgccgcgacgatcagcgcc
ggagagtggctgaccgcgagcggtgaatgggtaaacgaccgggttcatggccagcaattc
cggtcgaagttcctgcggacatcggcgccgaccacggccgaggggatcgagcgctatctg
gcctctggcatgatccgcggcattgggccggtgtatgcgaagaaactgatccgggccttc
ggtgacacggtgttcgacgtgatcgaggccaagcccgaacgcctgcgcgaggtgccgggt
atcggtgcggtgcgggccgggcggatcgtcaacgcctgggccgagcagaaggttgtgcgg
gagatcatggtgttcctgcatagccatggggtgagcacggcccgcgccgtgtggatcttc
aagacctacggcgctgacgccgtgcaggtgatgagcgagaacccgtatcgtctggcgcgg
gatatcagggggatcggtttccggacagcggatgcgatcgcggagaagctcggcatcgcc
agggacgcgatgatccgggtgcgtgccggcatcggacatgctctggcgacggcaatggat
gatggccattgtggcttgccggccggcgaactggtctcgctcgccgaaacgctgctcgag
gtgccggcgccgctgatcgggacggcactcgacctcgaactggcagagggcacggtgatc
gccgatcaggtggcggggactgactgtgtgttcctggccggcttgtatcgggcggaacag
ggtatcgccgagcggctgcgaattattgcctccggtgcaacatcctggccatcgatcgat
gccgacaaggcgatcggctgggtggaaagccatctcggcatgaatctggcggcgagccag
agtgaggcggtgcggctggcgctgaccgcaaagctgctggtgatcaccggcggaccgggt
gtcggcaagaccacgatcgtccgggcgatcctgcggatcctcgctgcaaaatccgtccgc
attctgctcgccgcgccgaccggccgggcagccaagcgtcttgccgagacgacggggttc
gaggcgaagacgatccaccgcctgctcgaggtagatcctgcgagcggcggcttccgccgc
ggcgtcgaccattcgctggaatgcgacctgctggtgatcgacgagacctcgatggtggac
gtgccgttgatgcatgcgctgaccagggcgatccccgacgaggcagcgctgctggtggtg
ggagatgtcgaccagcttccctcggtgggaccggggcaggtgctcgcggacctgatcggg
tctggcgcggtaccggtggtgcggctgacggagatcttccgccaggcagcggcaagccgg
atcataactgtggcgcatagcgtcaatcgcggggagatccccgatctcggccgcgccgat
cccgagagcgatttccatttcgtggcggccgacgagccggagacggcggtcgagcgcatc
gtggagttggtgaagacgcggattccgcgccggtttagactggatccgatccgcgatatc
caggtgctctgtcctatggcccggggtggggtcggcgcgcggtcactcaacatcaccctg
caggcggcgctgaacggcgcggcggaaccgcgggtcgagcgattcggctggacctacgcc
cccggcgacaaagtcatgcagatcgagaacgactacgaccgggaggtctacaacggcgat
atcggctttattgctcgggtcgatgcggaggctggtgagatcgctgtcggcttcgatgga
cgggaggtggtctacggtctcggcgagctggacgcgcttgtgccggcctatgcggcgacg
atccacaagtcccagggctctgaatacccagccgtcgtcattccggtgctgacccagcac
tacgtgatgctgcagcggaacctgctctacaccggcatcacgcgcggccggcggctagtc
gttctggtcggcagtcggcgtgctgtcgccatcgccgtgcggaatatctcggggcggcgc
cgatggtcgaagcttagggaatggctggggcagtag

DBGET integrated database retrieval system