KEGG   Acidiphilium cryptum: Acry_3376Help
Entry
Acry_3376         CDS       T00527                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
acr  Acidiphilium cryptum
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acry_3376
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acry_3376
Enzymes [BR:acr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Acry_3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pACRY02:90683..93145
Genome map
AA seq 820 aa AA seqDB search
MRLKNPMLTDGDIEAISPYGPARATIHGTPLNPDELERLDAYWDISLYLCLGMLYLRDNP
LLRTTLQPEHVKARLLGHWGSDAGQCFTYIHFNRLICKYDLDAMYISGPGHGAPAVLSQA
YLEGTYSEIYPEISEDLAGLRRFFNQFSFPGGIGSHATPETPGSIHEGGELGYSLSHAFG
TVFDNPDLITLVMVGDGEAETGPLATSWHGNKFLNPITDGAVLPVLHLNGYKINNPTILA
RISHEELEALFVGYGYTPYFVEGSDRASMHQAMAATMEHCVHEIRAAQGEARRTGKAFRP
RWPVIVLRSPKGWTGPRLVDNHYLEGSWRAHQIPIADVPCNPDHLKLLEDWMRSYRPEIH
FDGDGRIIPELRALAPKGLRRMSANPAANGGTIRRPLNLPDFRSFQVDVDHPGVRRAGNV
PTLGPFLREIIRENHDNFRIFGPDETQSNKLDSIYTAGKKSWLGAHFPEDEDGGNLAVAG
RVMEMLSEHTVEGWLEGYLLSGRHGLINSYEPFVHVIDSMFNQHAKWLEKCNELAWRVPI
SSLNILITALVWRQDHNGFTHQDPGFLDVVANKNPDVVRIYLPPDANCLLSVADHCLRSQ
NYVNVIVSDKQIHLQYLNMDAAIAHCAKGAGIWDWASNDHGQEPDVVMASCGDVPTVEAL
AATALLRTHLPDIKIRFVNCVDLFRLVPNWEHPHGLTDSEFEELFTATKPVIFNFHSYPW
LIHRLTYRRPAQHNIHVCGYGEKGNIDTPLELAIRNRTDRFSLAIDAISRIPRFRDSSSD
VLEVLLERRQACVQHAHEFGTDPKHISDWIWPKADSEGRS
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgaaaaatccgatgttgacggacggcgacatcgaggccatctcgccatacggt
ccggcgcgtgcgacaatccacggtacgccactgaacccggacgaactcgaaagacttgat
gcctactgggatatcagtctctatctctgcctcggcatgctgtatctgcgggacaatccg
ctgttacggacaacgctccagcccgaacacgtgaaggcgcgactgctcggccattggggc
tcggacgccgggcagtgtttcacttacatccatttcaatcggctgatctgcaaatatgac
ctggacgcaatgtatatttcgggaccagggcacggagcgccggcggtgctgtcgcaagcc
tatctcgaaggaacctattcggagatttatcctgagatcagcgaagatctcgccggcctg
aggcgtttcttcaaccagttttcgtttcccggtggaattggcagccacgcgacccccgag
acacctggaagcattcatgaaggcggtgaactgggttacagcctatcgcacgcctttggc
actgtgttcgacaatccggatctgatcacgctggtaatggtcggtgatggtgaagcggaa
accggccccctggcgacaagttggcacggcaacaagttcctcaacccgataacagacgga
gcggtactgccggtgctacatctcaatggatacaagatcaacaatccgacgatcctcgct
cggatcagccacgaggaactggaggcgctatttgtcggctacggctacaccccctatttc
gtcgagggtagcgatcgagccagcatgcatcaggcgatggcggcaacaatggagcattgt
gtgcacgagattcgcgcggcgcagggcgaggcgcggcggactggcaaagcattccggcca
cggtggccggtcatcgtgctacgtagcccaaagggctggaccgggccgcggctagtggac
aaccattacctcgaaggatcctggcgcgcccatcagatcccgatagccgatgtcccctgt
aatccggaccatctgaagctcctggaagactggatgcgcagttatcgaccggaaatccac
ttcgacggggatggtcggatcattccagagttgagggcactggccccaaagggtttgcgg
cgaatgagcgccaatccagcagccaatggcgggaccattcggcgtccgctcaatctgcct
gactttcgctcctttcaagttgatgttgatcatccaggagtgaggagagcaggcaacgtg
ccgacactcggtccgtttctgcgtgaaatcatccgtgaaaatcatgataattttcgcata
tttggccccgacgagacgcagtcgaacaagcttgattcgatctatacggccggcaagaaa
tcttggcttggcgcccattttccagaagacgaggacggaggcaatcttgcagtggctggg
cgggtcatggaaatgctcagcgagcacaccgtcgaaggttggcttgaaggctatctgctg
agtgggcgccacggcctgatcaacagttacgaacccttcgtgcatgtgatcgactcgatg
ttcaaccagcatgccaaatggctcgagaaatgtaacgagctagcgtggcgagtgccgata
tcatcgctcaacattctaatcacagcactggtgtggcggcaagatcataacgggtttacc
catcaggatcctgggtttcttgatgtcgtggccaacaaaaatccagatgttgttcgcatc
tatctgccaccggatgcaaactgcctgttatctgtggctgatcactgtctgcgtagtcag
aattatgtcaatgtcatcgtctccgacaagcagatacacctccagtatctcaacatggac
gccgcaatcgcccattgcgccaagggtgcgggcatctgggattgggcaagcaacgaccac
gggcaagagccagatgtcgtgatggcaagttgcggtgacgtgccgactgtggaggcactg
gcagcgaccgccctcctgcgtacacatctacctgacatcaaaatcaggtttgtaaattgc
gtcgatttgttcagattggtcccgaactgggagcatccacacggtctgaccgacagtgaa
ttcgaggagctgttcaccgcgacaaagccggtaatcttcaactttcattcttatccgtgg
ctcatccaccggctgacttatcgccggcccgcccaacacaacatccacgtttgcggttac
ggtgaaaaaggcaacatcgatacacccctcgagctcgccatccgcaatcggactgaccgc
ttcagtctggcgatcgacgctatcagccggatcccacgcttccgtgactcctcctccgat
gtacttgaggtcttgctggaacggcgacaagcctgtgttcagcacgctcacgaattcgga
accgatccaaaacacatctccgactggatttggccgaaagcagactccgaaggacgatct
taa

DBGET integrated database retrieval system