KEGG   Acidiphilium cryptum: Acry_3541Help
Entry
Acry_3541         CDS       T00527                                 

Definition
(GenBank) ATP-dependent DNA helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acr  Acidiphilium cryptum
Pathway
acr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acry_3541
Enzymes [BR:acr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Acry_3541
DNA repair and recombination proteins [BR:acr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Acry_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 HHH_2 Helicase_RecD AAA_11 PIF1 NTPase_1 AAA_16 AAA_22 T2SSE AAA_29 AAA AAA_5 CbiA HHH_3 ArgK AAA_23 AAA_28 TrwB_AAD_bind HHH NACHT IstB_IS21 RsgA_GTPase TsaE ABC_tran PhoH AAA_18 cobW UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: ABQ29141
UniProt: A5FU59
Position
pACRY03:complement(73588..75783)
Genome map
AA seq 731 aa AA seqDB search
MGNHFIATAPAQTPDREVLAGLVERVTFHNVENGFCVLRVKARGHRDLVTVIGHAATISA
GEWLTASGEWVNDRVHGQQFRARFLRTSAPTTAEGIERYLASGMIRGIGPVYAKKLIRAF
GETVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIMVFLHSHGVSTARAVRIF
KTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARDAMIRVRAGIGHALATAMD
DGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIADQVAGTDCVFLAGLYRAEQ
GIAERLRIVASGATPWPSIDADKAIGWVESHLGMNLATSQSEAVRLALTAKLLVITGGPG
VGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTGGEAKTIHRLLEVDPASGSFRR
GVDHPLECDLLVIDETSMVDVPLMHALTRAIPDEAALLVVGDVDQLPSVGPGQVLADLIG
SGAVPVVRLTEIFRQASASRIITVAHSVNRGEIPDLGRADPESDFHFVAADEPETAVERI
VELVKTRIPHRFGLDPIRDIQVLCPMARGGVGARSLNITLQAALNGAAEPRVERFGWTYA
PGDKVMQIENDYDREVYNGDIGFIARVDAEAGEVGVGFDGREVVYGLGELDGLVPAYAAT
IHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGITRGRRLVVLVGSRRAVAIAVRNVSGRR
RWSKLREWLSG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccattttattgccactgcccctgctcagacacccgatcgcgaggtcctcgct
ggcctggttgagcgggtgacgttccacaatgtcgagaacggcttttgcgtgttgcgggtg
aaagcccgggggcaccgtgatctcgttacagtcatcgggcatgccgcgacgatcagcgct
ggcgagtggctgacggcgagcggcgagtgggtgaacgaccgggttcatggccagcaattc
cgggcgcggttcctgcggacatcggcgccgaccacggccgaggggatcgagcgctatctg
gcctcgggcatgatccgcggcatcgggccggtgtatgcgaagaaactgatccgagccttc
ggcgagacggtgttcgacgtgatcgaggcaaagcccgagcgcctgcgcgaggtgccgggt
atcggcgcggtgcgggccgggcggatcgtcaatgcctgggccgagcagaaggtggtgcgg
gagatcatggtgttcctgcacagccatggggtgagcacggcccgcgccgtgcggatcttc
aagacctacggcgccgacgcggtgcaggtgatgagcgagaacccgtatcgtctggcgcgg
gacatcagggggatcggtttccggacagcggatgcgatcgcggagaagcttggcatcgcc
agggacgcgatgatccgtgtgcgtgctggcatcggtcatgcgctggcgacggcaatggat
gatggccattgtggcctaccggccggcgaactggtctcgctcgccgaaacgttgctcgag
gtgccggcgccgctgatcgggacggcactcgacctcgaactggcagagggcacggtgatc
gccgatcaggtggcggggactgactgtgtgttcctggccggcttgtatcgggcggagcag
ggtatcgccgaacggctgcggattgttgcctctggtgcaacgccctggccatcgatcgat
gcggacaaggcgatcggctgggtggaaagccatctcggcatgaatctggcgacgagccag
agtgaggcggtgcggctggcgctgaccgcgaagctgttggtgatcaccggcggaccgggt
gtcggcaagaccacgatcgtccgggcgatcctgcggatcctcgctgcgaaatccgtccgc
attctgctcgccgcgccgaccggccgggcagccaagcgccttgccgagacgacggggggc
gaggcgaagacgatccaccgcctgctcgaggtagatcctgcgagcggtagtttccgccgc
ggcgtcgaccatcctctggaatgcgaccttctggtgatcgacgagacctcgatggtggac
gtgccgttgatgcatgcgctgaccagggcgatccccgacgaggcagcgctgctggtggtg
ggagatgtcgaccagcttccctcggtgggaccggggcaggtgctcgccgatctgatcggg
tctggcgcggtaccggtggtgcggctgacggagatcttccgccaggcatcggcgagccgg
atcatcaccgtggcgcatagcgtcaatcgcggggagatccccgatctcggccgcgccgat
cccgagagcgatttccatttcgtggcggccgacgagccggagacggcggtcgagcgcatc
gtggagctggtgaagacgcggattccgcaccggtttggactggatccgatccgcgacatc
caggtgctctgtccgatggcccggggtggggtcggcgcgcggtcactcaacatcaccctg
caggcggcgctgaacggcgcggcggaaccgcgggtcgagcgattcggctggacctatgct
cccggcgacaaggtcatgcagatcgagaacgactacgaccgggaggtctacaacggcgat
atcggctttattgcccgggtcgatgcggaggccggggaggttggcgtcggcttcgatgga
cgggaggtggtctacggtctcggcgagctggacgggcttgtgccggcctatgcggcgacg
atccacaagtcccagggctcggaataccctgccgtcgtcattccggtgctgacccagcac
tacgtgatgctgcagcggaacctgctctacaccggcatcacgcgcggccggcggctagtc
gttctggtcggcagtcggcgtgctgtcgccatcgccgtgcggaatgtctcggggcggcgc
cgatggtcgaagctcagagagtggctgtcaggatga

DBGET integrated database retrieval system