KEGG   Anolis carolinensis (green anole): 100529108Help
Entry
100529108         CDS       T01608                                 

Gene name
st6gal2
Definition
beta-galactoside alpha 2,6-sialyltransferase ST6Gal II
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100529108 (st6gal2)
   00514 Other types of O-glycan biosynthesis
    100529108 (st6gal2)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100529108 (st6gal2)
Glycosyltransferases [BR:acs01003]
 Terminal extension
  Sialyltransferase
   100529108 (st6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 663 aa AA seqDB search
MNLHCRAIVVTECQQWYDGADCHAVKIKFQKSLQNKALGNNSRNLKESGVPVGPAWPVPP
PMVCVLAQPGCVRWESFQAMVKTQPGRTVTTCSLAGPGRAPREAEPDLATPPAARNHASR
VAPLRYRGIGKDIAMKPNLKQWKQVMLFGIFAWGLLFLVIFIYFTDSNTADAVPSSFSYI
ETKRLLPIQGKQRAIMGAIHDPSFSESAVGNEVLLSDDVLDSFKSGTGSIKKWTDLEDDF
ESEEEFFPSQLRRKSKSAFYQRDSDYLFAAGQPQSQSSVQQIVKLISAEGEDQTRKAFQN
NWLSQRKIKRRHTRHRRSQMFEESDEWDGIYSTMSKSFLYRLWKGDVSSKMLNPRLQKAM
KDYLNTNKHGVRFRGKRNSKLTSEQLFCELKARVNIRTIDGKEAPFSILGWEKHVPQISL
NKLYPNGFGSCAVVMSAGAILNSSLGKEIDSHEAVLRFNSAPTRGYEKDVGNKTTMRIIN
SQILTNPNHHFIENSLYKDVILVAWDPAPYSANLNVWFKKPDYNLFTPYVQHRRKNPNQP
FYILHPKFIWQLWDIIQENTKEEIQPNPPSSGFIGILIMMSMCHEVHVYEYIPSVRQTDL
CHYHELYYDAACTLGAYHPLLYEKLLVQRMNKGFQDDLYRKGKVILPGFRSVKCPGHNRF
PYT
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcactgccgagccattgtggtcacagagtgccagcagtggtatgatggtgct
gattgtcatgctgtaaaaataaagttccaaaaatcgttacaaaataaagccttagggaat
aattcaagaaatctcaaggaatcgggcgtgccggtgggaccggcgtggccggtcccgcct
cccatggtgtgcgtcctggcccagccaggctgcgtgcggtgggagtccttccaggccatg
gtgaagacccagcctggaaggactgtcaccacatgcagcctggctgggccagggcgtgcc
ccgcgggaagcagagccagacctggccacgcctcccgcagcgcgcaaccatgcctcccgc
gtagcacctttaaggtacagagggattggcaaagacattgccatgaaacctaacctgaag
caatggaaacaagtaatgctgtttggaatatttgcatggggcctcctattcctggtgatc
ttcatctatttcacagatagtaacactgctgatgcagttcccagttctttttcttacatt
gagactaaaaggcttttgcctattcagggcaaacagagagctatcatgggagccattcat
gacccatccttttctgaatcagcagttgggaatgaagtgctgctcagtgacgatgtctta
gactcatttaaatcaggaactgggagcattaaaaagtggactgacttagaggatgacttt
gaaagcgaggaagaatttttcccttctcaattaagaagaaaatcaaaaagtgctttctat
caaagggatagtgattatttatttgctgctggtcagcctcagtcacagagcagtgttcag
caaatagtgaaattaatctctgcagagggggaggatcagacgagaaaggcttttcagaat
aattggctctctcaaaggaagataaagagaaggcacacaagacacagaagaagccaaatg
tttgaagagtctgatgagtgggatggaatatattctacaatgtcaaaatcgttcctgtac
aggctttggaaaggggacgtctcctccaagatgctgaatcctcgcctccagaaagcaatg
aaagattacctgaataccaataagcatggagtgcggtttagagggaagagaaactccaag
ctgacttctgaacagctcttctgtgagctgaaggcacgggtgaacatccgaaccattgat
ggcaaagaagcccccttctctatccttggatgggaaaagcatgtgccccagatttctcta
aataaactatatccaaatgggtttggaagctgtgctgttgtgatgtctgctggtgccata
ctgaactcttctcttgggaaagaaattgattcccatgaggcagttctacgattcaattca
gctccaacccgaggttatgaaaaagatgttggaaataaaaccaccatgcgtattattaat
tcccagattcttaccaatccaaaccatcatttcattgagaactccttatataaagatgtt
atcttagtagcttgggatcctgctccctattctgcaaatctcaatgtgtggtttaagaaa
ccagactacaatttgtttactccatacgtacaacatcgcagaaagaatccaaaccaacca
ttttacattctccatccaaaatttatatggcagctctgggatatcattcaagaaaatacc
aaggaagagatacaacccaaccctccttcatcaggtttcatcggaatcctcatcatgatg
tcaatgtgccatgaagtgcatgtctatgaatacattccttcagtccgacagactgatctt
tgccactaccatgaactttactatgatgcagcgtgtaccttgggggcctaccacccactg
ctttatgaaaaactgttggtgcagaggatgaacaaaggcttccaggatgatctgtaccga
aaagggaaagtaattttgccagggttcaggtcagtgaagtgccctggacacaatcggttt
ccatatacataa

DBGET integrated database retrieval system