KEGG   Anolis carolinensis (green anole): 100529109Help
Entry
100529109         CDS       T01608                                 

Gene name
st6gal1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100529109 (st6gal1)
   00514 Other types of O-glycan biosynthesis
    100529109 (st6gal1)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100529109 (st6gal1)
Glycosyltransferases [BR:acs01003]
 Terminal extension
  Sialyltransferase
   100529109 (st6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 404 aa AA seqDB search
MVHVSSFRKCIYVLLAFILVLTICLWKETRKGVIFSLRLEGRSDHIPWKMWRWGTSKEEP
VQEVAVIATGKVPLLSNTEVNLSTKVTRSNLIIKVWNKDSTSQSLHPRLQKARQTYLKIN
KYKVNYSGPKHAHKLRPKELLCQLRNRLDFRMITATDSPFDISEWEPYVPKGNISIKLGR
CAVVSSAGSMKSSHLGEDIDSHDAVLRFNGAPIKGFQADVGEKTTIRLVNSQLITVEEKK
FLADPQYNFGTLILWDPAPYHSSIKEWYKKPDYNFYGSFKHYRKKYPKQPFYILNPHMQW
QLWDILQENSPEDIQPNPPSSGMLGKLIMMNFCDEVDVYEYLPSKRQTNICHYYQKIFDQ
ACTMGAYHPLLFEKNIIKHLNIGKDEDIYNYGKATLPGLRNVQC
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggttcatgtcagctcattcagaaaatgtatatacgttctcctggcatttattttggtt
ttgactatttgtttgtggaaggaaacccggaagggtgtcattttttctctaaggttagaa
ggacgatctgaccacataccgtggaagatgtggcgatggggcacctcaaaagaagaacca
gtccaagaagtagctgtcattgccaccggcaaggtccctttgttatcaaacactgaagtt
aacctctctacaaaagtgacaagaagcaatttaattatcaaagtatggaacaaagacagt
acatcccaaagcctccatcccagattgcagaaggcaaggcaaacctatttgaaaattaac
aagtataaggtgaattattctggaccgaagcatgctcataaactcagacctaaggaactg
ttatgtcagcttcgaaatcggctggatttcaggatgataactgctacagatagtcccttc
gatatatcagaatgggagccatatgtgccaaagggaaacatcagcataaaactgggccga
tgtgctgttgtgtcttcagcaggatccatgaagtcatcccatttgggggaagatatagat
agtcatgatgctgtgctgcggtttaatggggcccctatcaaaggatttcaggctgatgta
ggagagaaaaccacaattcgccttgtaaattcccagcttattactgttgaagaaaaaaag
tttcttgcagacccacagtataactttggaaccttaattttatgggatccagcaccttat
cactcaagtattaaagagtggtataaaaaaccagactacaatttttatggaagtttcaag
cactataggaaaaagtatccaaaacaacccttttatatcctgaatccgcacatgcagtgg
cagctctgggatatccttcaagaaaactcccctgaagatattcagccaaatccaccatct
tcaggaatgcttggtaagttgattatgatgaatttctgtgacgaagtggatgtttatgaa
tatctcccttccaaaaggcaaacaaacatttgtcattattaccagaagatctttgaccaa
gcttgcactatgggtgcctatcacccactcctctttgagaaaaatataatcaagcatctt
aatataggcaaagatgaagacatttacaattatgggaaagcgactcttcctggcctaagg
aatgtacagtgttag

DBGET integrated database retrieval system