KEGG   Anolis carolinensis (green anole): 100551589Help
Entry
100551589         CDS       T01608                                 

Definition
uncharacterized LOC100551589
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100551589
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100551589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 484 aa AA seqDB search
MGQEAGLRGAGGGIVWGGKEDVPGHFAEEKSGARFSRQQSAQESLPSRQEDVPGCFAEEK
SGTHFALQQSAQESLPSRQEDVPGCFAEEKSGTHFALQQSAQESLPSRQEDVPGCFAEEK
SGTHFALQQSAQESLPSRQEDVPGCFAEEKSGTHFALQQSAQESLPSCQEDVPGHFAEEK
SGARFSLQQSAQEHLPSRQEDVPGCALLRQGPGHGGKAHPKGGRALMNSSEAMNFLEGGS
LAEEFLRIEREQMVRLGDLTFPESVRYVYKPLDYAWEPHQDYVHRYCRSPKEVLFLGMNP
GPFGMAQTGVPFGAVQPVRDWLQVRGEVSRPACEHPKRPIRGLECPQTEVSGARFWGFFR
SLCASPDVFFRRCFVHNHCPLLFVSESGRNLTPADLPAAQREQLLQVCDDALCKTVKLLG
IVMVIGVGRFAEQRARKALAASGITVRVEGVMHPSPRNPQANKGWDAIMRAKLEELGVMP
LITG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggaggcgggactgcgcggggcgggaggcgggatcgtgtggggtgggaaggaa
gacgttcctgggcactttgctgaggagaaaagcggcgcccgcttttctcgtcagcaaagc
gcccaggaaagtttgccttctcgccaggaagacgttcctgggtgctttgctgaggagaaa
agcggcacccacttcgctcttcagcaaagcgcccaggaaagtttgccttctcgccaggaa
gatgttcctgggtgctttgctgaggagaaaagcggcacccacttcgctcttcagcaaagc
gcccaggaaagtttgccttctcgccaggaagacgttcctgggtgctttgctgaggagaaa
agtggcacccacttcgctcttcagcaaagcgcccaggaaagtttgccttctcgccaggaa
gacgttcctgggtgctttgctgaggagaaaagcggcacccacttcgctcttcagcaaagc
gcccaggaaagtttgccttcttgccaggaagatgttcctgggcactttgctgaggagaaa
agcggtgcccgcttctctcttcagcaaagcgcccaggaacatttgccttctcgccaggaa
gatgttcctgggtgtgctttgctgaggcaaggcccaggtcacggcgggaaggcccatccc
aaaggtggaagagctctgatgaactcctcagaggccatgaacttcttggaagggggcagc
ttggctgaagagtttctgcgcattgaacgagagcaaatggtccgcctgggggacctcacc
ttcccagagtcagttcgatatgtttacaagcctctggattatgcctgggagccacaccaa
gattatgtgcatcgatactgccggtctcctaaggaggtgctctttcttggcatgaaccct
ggaccttttggtatggcacagactggggtgccatttggagcagtgcagcctgtccgagac
tggctccaggtacgtggagaggtttctaggccggcatgtgagcaccccaagagacccatc
cggggcctggagtgcccccagaccgaggttagtggagcccgcttttggggtttcttccgc
tccctgtgtgccagtcctgatgtcttcttccgccgctgttttgttcacaaccactgccca
ttgcttttcgtcagcgagagtgggcgcaacctgactccggcagacctgccagcagcccag
cgggaacagctcttgcaggtctgcgatgatgcgctgtgcaaaacggtgaagctattgggc
attgtgatggtcattggtgtgggacggtttgcggaacagcgggcccgcaaggccctggcg
gcctctggtatcaccgtgcgggttgagggagtgatgcacccatcacctcgcaatccacag
gctaataagggctgggatgctatcatgagagcaaaactggaggagcttggcgtgatgcct
ctcatcacaggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system