KEGG   Anolis carolinensis (green anole): 100551589Help
Entry
100551589         CDS       T01608                                 

Gene name
smug1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100551589 (smug1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100551589 (smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 258 aa AA seqDB search
MNSSEAMNFLEGGSLAEEFLRIEREQMVRLGDLTFPESVRYVYKPLDYAWEPHQDYVHRY
CRSPKEVLFLGMNPGPFGMAQTGVPFGAVQPVRDWLQVRGEVSRPACEHPKRPIRGLECP
QTEVSGARFWGFFRSLCASPDVFFRRCFVHNHCPLLFVSESGRNLTPADLPAAQREQLLQ
VCDDALCKTVKLLGIVMVIGVGRFAEQRARKALAASGITVRVEGVMHPSPRNPQANKGWD
AIMRAKLEELGVMPLITG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaactcctcagaggccatgaacttcttggaagggggcagcttggctgaagagtttctg
cgcattgaacgagagcaaatggtccgcctgggggacctcaccttcccagagtcagttcga
tatgtttacaagcctctggattatgcctgggagccacaccaagattatgtgcatcgatac
tgccggtctcctaaggaggtgctctttcttggcatgaaccctggaccttttggtatggca
cagactggggtgccatttggagcagtgcagcctgtccgagactggctccaggtacgtgga
gaggtttctaggccggcatgtgagcaccccaagagacccatccggggcctggagtgcccc
cagaccgaggttagtggagcccgcttttggggtttcttccgctccctgtgtgccagtcct
gatgtcttcttccgccgctgttttgttcacaaccactgcccattgcttttcgtcagcgag
agtgggcgcaacctgactccggcagacctgccagcagcccagcgggaacagctcttgcag
gtctgcgatgatgcgctgtgcaaaacggtgaagctattgggcattgtgatggtcattggt
gtgggacggtttgcggaacagcgggcccgcaaggccctggcggcctctggtatcaccgtg
cgggttgagggagtgatgcacccatcacctcgcaatccacaggctaataagggctgggat
gctatcatgagagcaaaactggaggagcttggcgtgatgcctctcatcacaggctga

DBGET integrated database retrieval system