KEGG   Anolis carolinensis (green anole): 100551664Help
Entry
100551664         CDS       T01608                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETMAR
  KO
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100551664
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100551664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 304 aa AA seqDB search
MLRPLLKVQRQSGMDVSGGLEEVSVSAGPQFEDAPAFQYSPDHVAGKEGKPDPSEISFPG
CSCHSASCVASSCSCLRYGENYNGLCIKSDKNGLNFCKPIFECNTMCQCGELCQNRVIQR
GLQFRLEVFKTAKKGWGLRTLEFIPKGRFVCEYAGEILGFKEACRRIHLQTPSDANYIIA
VKEHLSDGHIMETFVDPTHIGNVGRFLNHSCEPNLFMVPVRIDSMVPKLALFADRDICAE
EELTYDYSGRYRNYSPVKDQDNLPEGEASKKLCYCGTKLCTGFLPFDNSLFCNSDVRSHN
EETL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggcctctcctgaaggttcagaggcaaagcggcatggacgtgagtggagggctg
gaggaggtgtccgtgtctgcggggccgcagttcgaggacgccccggcttttcagtatagc
ccagatcacgtggctggaaaagaaggcaaaccagacccctctgagatttcctttcctggc
tgcagctgtcattctgcttcctgtgtggcttccagttgttcatgccttcgctatggggaa
aactataacggattgtgtataaaaagtgataaaaatggactgaatttctgcaaacctatt
tttgaatgcaacactatgtgccagtgtggagagctgtgccaaaacagagtaattcagaga
ggcttacaattcagacttgaagtctttaagacagctaaaaaaggatggggtcttcgcaca
ctggagttcatccccaaaggaagatttgtgtgtgaatatgctggtgaaatcctgggcttt
aaagaagcatgtcgaaggatacatctgcaaacgccaagcgatgcaaattatattatagca
gtaaaggaacacttgtccgatgggcacatcatggagacatttgtggatcccactcacatt
ggtaatgttgggagattcctgaaccactcttgtgagccaaacctctttatggtccctgtc
cgaatagactccatggtgcctaaactggcactttttgctgatcgtgatatttgtgcagag
gaagaacttacatatgattattctggaagataccgtaattattcacctgtcaaagatcag
gacaaccttccagaaggggaagcatctaaaaagctctgttactgtgggaccaaattgtgt
acaggtttcttgccttttgataattctttattctgcaacagtgatgtaagaagtcataat
gaggaaactttgtag

DBGET integrated database retrieval system