KEGG   Anolis carolinensis (green anole): 100551939Help
Entry
100551939         CDS       T01608                                 

Gene name
setd7
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100551939 (setd7)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100551939 (setd7)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100551939 (setd7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 380 aa AA seqDB search
MDSDEETLEETVEGTHWACRKQQQEEEGTLDDDGMPHGFCTVTYSSTDRFEGNFVHGEKN
GRGKFFFFDGSTLEGYYVDDGLQGQGVYNYEDGGALHGTYMDGELNGPAQEYDPDGRLIF
KGQYKDNIRHGICWIYHPDGGHLVGEVNDEGEMTGDKIAYVYPDKKTAYYGQFIDGEMID
AKLATLISVEGGKPQFEVLPGSPVYSFDKSTSSCISTNALLPDPYESERVYVDTSLISSA
GEGLFSKIAAGSYTVMSFYNGVRITHQEVDSRDWALNGNTISLDDETVLDVPEPYNYVSK
YCASLGHKANHSFTPNCIYDSFVHPRFGLIKCIRTTRAVEKDEELTVAYGYDHNSTEQNG
PEAPEWYLVELTAFQASQKK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgacgaggagacgctggaagagaccgtcgagggtacgcactgggcctgcagg
aagcagcagcaggaggaggagggaactcttgatgatgatgggatgccacatggattctgt
acagtcacatattcatccacagacagatttgaaggtaactttgtccacggagaaaagaat
ggccgtggaaagttctttttctttgatggaagcactctagaaggatattatgttgatgat
ggtctgcaaggccaaggagtgtacaattatgaagacggaggggctctccatggcacctat
atggatggcgaactgaatgggccagcacaggagtacgatcctgatggacgattgatattc
aaagggcaatacaaggataacattcgccatgggatttgttggatataccatccagatggg
ggtcacctggttggagaggttaatgacgaaggagagatgactggagacaaaatagcttat
gtatatcctgataagaagacagcctattatggacagtttatcgatggtgaaatgatagat
gcaaagttggcaactcttatatccgtagaagggggaaagccacaatttgaagtactacct
ggcagcccagtatacagttttgataaatctacttcatcctgcatttctacaaatgcactt
cttcctgatccttatgaatcagagagggtatatgttgacacatctctcatttccagtgct
ggggaagggttattttctaaaatagcagctggatcttacacagtcatgtccttttacaat
ggtgtacgaattacacaccaagaggtggacagcagggactgggcgttgaatggaaacacg
atatcccttgatgatgaaacagtcttagatgtaccagaaccctacaactatgtatctaaa
tactgtgcctccctgggacacaaagcaaaccactctttcacaccaaactgtatctatgac
tcatttgttcatcctcgatttgggctgattaagtgcattcgtacaactagagctgtggag
aaagatgaagaattaacagtagcttatggatatgatcataattccacagaacaaaatggc
ccagaagcacctgagtggtacttagtagaactgacagccttccaggcatcacagaaaaag
tga

DBGET integrated database retrieval system