KEGG   Anolis carolinensis (green anole): 100551939Help
Entry
100551939         CDS       T01608                                 

Gene name
setd7
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:acs00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 380 aa AA seqDB search
MDSDEETLEETVEGTHWACRKQQQEEEGTLDDDGMPHGFCTVTYSSTDRFEGNFVHGEKN
GRGKFFFFDGSTLEGYYVDDGLQGQGVYNYEDGGALHGTYMDGELNGPAQEYDPDGRLIF
KGQYKDNIRHGICWIYHPDGGHLVGEVNDEGEMTGDKIAYVYPDKKTAYYGQFIDGEMID
AKLATLISVEGGKPQFEVLPGSPVYSFDKSTSSCISTNALLPDPYESERVYVDTSLISSA
GEGLFSKIAAGSYTVMSFYNGVRITHQEVDSRDWALNGNTISLDDETVLDVPEPYNYVSK
YCASLGHKANHSFTPNCIYDSFVHPRFGLIKCIRTTRAVEKDEELTVAYGYDHNSTEQNG
PEAPEWYLVELTAFQASQKK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgacgaggagacgctggaagagaccgtcgagggtacgcactgggcctgcagg
aagcagcagcaggaggaggagggaactcttgatgatgatgggatgccacatggattctgt
acagtcacatattcatccacagacagatttgaaggtaactttgtccacggagaaaagaat
ggccgtggaaagttctttttctttgatggaagcactctagaaggatattatgttgatgat
ggtctgcaaggccaaggagtgtacaattatgaagacggaggggctctccatggcacctat
atggatggcgaactgaatgggccagcacaggagtacgatcctgatggacgattgatattc
aaagggcaatacaaggataacattcgccatgggatttgttggatataccatccagatggg
ggtcacctggttggagaggttaatgacgaaggagagatgactggagacaaaatagcttat
gtatatcctgataagaagacagcctattatggacagtttatcgatggtgaaatgatagat
gcaaagttggcaactcttatatccgtagaagggggaaagccacaatttgaagtactacct
ggcagcccagtatacagttttgataaatctacttcatcctgcatttctacaaatgcactt
cttcctgatccttatgaatcagagagggtatatgttgacacatctctcatttccagtgct
ggggaagggttattttctaaaatagcagctggatcttacacagtcatgtccttttacaat
ggtgtacgaattacacaccaagaggtggacagcagggactgggcgttgaatggaaacacg
atatcccttgatgatgaaacagtcttagatgtaccagaaccctacaactatgtatctaaa
tactgtgcctccctgggacacaaagcaaaccactctttcacaccaaactgtatctatgac
tcatttgttcatcctcgatttgggctgattaagtgcattcgtacaactagagctgtggag
aaagatgaagaattaacagtagcttatggatatgatcataattccacagaacaaaatggc
ccagaagcacctgagtggtacttagtagaactgacagccttccaggcatcacagaaaaag
tga

DBGET integrated database retrieval system