KEGG   Anolis carolinensis (green anole): 100551984Help
Entry
100551984         CDS       T01608                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:acs00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 308 aa AA seqDB search
MASNPSVLMRLVASAFSVANKAGVIVRKVMAGGDLGIVEKSGANDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPSEEVDEQLLEDGQCEEILKKACPQQYTAIKEEELVVWVDPLD
GTKEYTEGLLDHVTVLIGIAYEGKAIAGVINQPYYNYEAGADTVLGRTIWGVLGLGAFGF
ELKEVPAGKHIIITTRSHSSKLVNDCISAMNPDSVVRVGGAGNKIIQLVEGKASAYVFAS
PGCKKWDTCAPEAILHAVGGKLTDIHGNFFQYNKEVKHMNSAGVLAALKNHDYYASRIPD
TVKQALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatccaagtgtacttatgcgtcttgtggcgtctgcattttctgttgctaat
aaagcaggagtaattgtccggaaagtgatggctggaggagatctgggcatagtagagaag
agtggagctaatgacctgcagaccaaagctgaccggctggttcagatgagcatctgttcc
tctttagcacgaaaatttcctaaactgacaatcattggagaagaggatcttccttctgaa
gaagtagatgaacagttacttgaggatggccaatgtgaagaaatactgaagaaagcctgc
ccacagcagtacactgccatcaaagaggaagagctcgtcgtatgggttgaccctctggat
ggaaccaaagaatatactgaaggacttcttgaccatgtcacagtccttattggaattgct
tatgaaggaaaagctattgcaggagtcattaaccaaccctactataactatgaggcagga
gcagacacagtcttaggcaggacaatctggggagtcctgggtctgggagcctttggattt
gagctgaaggaggttcctgcaggaaagcatattatcatcacgacaagatcacacagcagc
aagctagtaaatgactgcattagtgcaatgaaccctgatagtgtggtgagagtgggaggt
gcaggaaataagatcattcaacttgtagaaggcaaggcttctgcttatgtatttgccagc
cctgggtgtaagaagtgggatacatgtgcaccagaagctattttgcatgctgtaggaggc
aaacttactgatattcatgggaatttctttcagtataacaaagaggtgaagcacatgaat
tcagcgggtgtccttgctgctttgaaaaaccatgactattatgcttctcgaattcctgac
acagttaaacaggcccttgtaccctaa

DBGET integrated database retrieval system