KEGG   Anolis carolinensis (green anole): 100551984Help
Entry
100551984         CDS       T01608                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100551984
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100551984
Transfer RNA biogenesis [BR:acs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100551984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 308 aa AA seqDB search
MASNPSVLMRLVASAFSVANKAGVIVRKVMAGGDLGIVEKSGANDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPSEEVDEQLLEDGQCEEILKKACPQQYTAIKEEELVVWVDPLD
GTKEYTEGLLDHVTVLIGIAYEGKAIAGVINQPYYNYEAGADTVLGRTIWGVLGLGAFGF
ELKEVPAGKHIIITTRSHSSKLVNDCISAMNPDSVVRVGGAGNKIIQLVEGKASAYVFAS
PGCKKWDTCAPEAILHAVGGKLTDIHGNFFQYNKEVKHMNSAGVLAALKNHDYYASRIPD
TVKQALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatccaagtgtacttatgcgtcttgtggcgtctgcattttctgttgctaat
aaagcaggagtaattgtccggaaagtgatggctggaggagatctgggcatagtagagaag
agtggagctaatgacctgcagaccaaagctgaccggctggttcagatgagcatctgttcc
tctttagcacgaaaatttcctaaactgacaatcattggagaagaggatcttccttctgaa
gaagtagatgaacagttacttgaggatggccaatgtgaagaaatactgaagaaagcctgc
ccacagcagtacactgccatcaaagaggaagagctcgtcgtatgggttgaccctctggat
ggaaccaaagaatatactgaaggacttcttgaccatgtcacagtccttattggaattgct
tatgaaggaaaagctattgcaggagtcattaaccaaccctactataactatgaggcagga
gcagacacagtcttaggcaggacaatctggggagtcctgggtctgggagcctttggattt
gagctgaaggaggttcctgcaggaaagcatattatcatcacgacaagatcacacagcagc
aagctagtaaatgactgcattagtgcaatgaaccctgatagtgtggtgagagtgggaggt
gcaggaaataagatcattcaacttgtagaaggcaaggcttctgcttatgtatttgccagc
cctgggtgtaagaagtgggatacatgtgcaccagaagctattttgcatgctgtaggaggc
aaacttactgatattcatgggaatttctttcagtataacaaagaggtgaagcacatgaat
tcagcgggtgtccttgctgctttgaaaaaccatgactattatgcttctcgaattcctgac
acagttaaacaggcccttgtaccctaa

DBGET integrated database retrieval system