KEGG   Anolis carolinensis (green anole): 100552081Help
Entry
100552081         CDS       T01608                                 

Gene name
plce1
Definition
(RefSeq) phospholipase C, epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100552081 (plce1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100552081 (plce1)
   04070 Phosphatidylinositol signaling system
    100552081 (plce1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100552081 (plce1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100552081 (plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 2166 aa AA seqDB search
MYAEIKLKMDGSQVEFKSLGSQSSVNKNETDRPDLNYVTERNNISKHLCTLHNRFVWDDC
LQRVKIYNNCTSSSTTCTCNLMELPTTHGDKTGQQLRDTNDSSTDSCFHLETATQKLSVA
CSDHSFSSVNFLGKIPSKPNLSHLENCSESNGEESEEDLSRSKKERSTLLTRRFCKNDKK
VKKTVYTGTRAIVRTLPSGHIGMVASNSIDRSKTHNELRHCRVTSDQLVTFQISRSQALR
SYLLQSIWHEIFKTATGSEDSLKYFLHPVKEPLTPQRHTDCWCERDNLCIKSCIQASEYC
ATLHRTSLSNFVSGALLEATTSLGARSGSLNILGGSTGKTMLKERKLSSSMAGSNVLTSA
VAGISKELVDLQHLIQFPEEVASILTEQEQDLYRKVLPIDYLCFLTRDLGNAECQNKLST
IKASISATLLSASNGEHSAVEDLVTRFNEVSSWVTWLILTAGSMEEKRDVFSYVVHVAKC
CWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEYRKVVNRA
LNIPGCKVVPFCGVFLKELCEVLDGAASLIRLCPQYNSQDETLEFVAEYNGQDNYLQRVG
RDGLHSVEKESAANYIFQTIRSCNRSLESEDGEDNFIEDEGGSSRRNSLKDRNRYLFITG
DLSDSESDLFEQSREWTPPAAEEQQQAFCHGIELIPWYVLSIRADVHQFLLQGATVIHYD
QETHFSARCFLQLQPDNSTLTWTKPTTACCTNSKMRLNMLGTTAELGKFQFLGNTGINGL
VEGCLDLFSAKAVYMGHSGIDMHSVCIQNKLCNMSLEENGVTLLYGLQTTENKLLHFVAP
KYTAKMLFDGLLELICATRKMKKFPDQRLQWLRKQYVSLYQEDSRYEGPTLAQAVELFGG
RRWSTRNTSPGNLMKNVEKPGVQRNNTLGINTAKKKKKVLMRGESGDGTDDEMTTRKART
FKENRSRSGSDPQDIDEQEDAEPSLLVTFLGTNTLPSRRSQSLTTSAPPNVTPGVSPVRP
VSSPVMSSSIKSQSSTWSSSSWHGRVKGGLKGFQTCMVSDNNMSFVEFVELFKSFSVRSR
KDLKDLFDVYAVPCNRLGSDSAPLYTSLKIDENTNGLQPDLDLLTRNISDLGLFIKNRQQ
LSDNQRQISDAIAAASIVTNGTGVESTSLGIFGVGIQQLNDFLVNCQGEHYTYDELLSII
QKFEPSINMCQQGLMSFEGFARFLMDKDNFASLNNESQENIDVLVFPLSYYYIESSHNTY
LTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKEVVEAID
RSAFFTSDMPIIISIENHCSLPQQRKMADIFKNTFGEKLVTKFLFESDFSDDPMLPSPLQ
LRGKILLKNKKLKAHQTPVDILKQKAHQLAHMQAQASNGSNVVNLSTPNEEEEDEEDEYD
YDYESLSDADVLNASPAPNCQEDNILEDRPENKLTIDKLQFEYCEETAKRIKKMDSAIYN
NKGKIYDMELGEEFYLSQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPSGSSRGKERK
SRKSIFGNNPGRLSPGEPAILAKASGKGAFDSARQNWEEACPPTFSPTTSLSSIIRTPRC
YHISSLNENAAKRLCRRYSQKLIQHTTCQLLRTYPAATRIDSSNPHPLLFWLHGVQLVAL
NYQTDDLPLHLNAAMFESNGGCGYVLKPPVLWDRNCPMYQHFCPLERDLDNMEPAIYSLT
IVSGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRIHFEDLV
FLRFAVVENNSSAVMAQRIIPLKALKRGYRHLQLRSLHNEALEISSLFINSRRMEENSSG
IAIPSSLRFSTPERRSAALYKVTIHGVPGPEPFTLFTIRQGTTVAQLLHQILVATKSIGT
YPADYFLMEEKCFISKERNEYRKPPFQRLLGPEEEIVQLLNSWFPEEGYVGRILFKTREE
NLNGRNLFQEEKEDAVASSEDDSFFVQVHDVSPEQPRTVIKAPRFSTAQDVIQQTLCKAK
YSYSILSNPNPSDYVLLEEVTKESTSKKSSASKTSQRILSDQECVFQAQNKWKGAGKFIL
KLKEQVQTGRDDKRKGISFANELKKLTKSSKQYRGFITSPLQTSSESLPSKNDKTACGLT
FSDTME
NT seq 6501 nt NT seq  +upstreamnt  +downstreamnt
atgtatgccgaaatcaaattaaaaatggatggatctcaagttgagtttaagtcactagga
agccaatcctcagtaaataaaaatgaaaccgacagacctgatttaaattacgttacagaa
agaaataatatctcaaaacatctgtgtactttgcacaacaggtttgtttgggatgattgt
ctccagcgagtaaagatttataataattgcaccagttcttccacaacctgcacttgtaac
ttaatggaactaccaactacccatggggataaaactggacaacagttgcgggacaccaat
gactcctcaactgatagctgttttcatttagaaacagcaacccaaaaactcagtgtggca
tgttctgatcacagcttctcaagtgttaattttcttggaaaaattccttcaaagcctaac
ctgagccatttggaaaactgcagtgaaagcaatggagaagagtcagaggaagatctttct
cgaagtaagaaagaacgctccaccttattaaccagaagattttgcaaaaatgacaagaag
gttaagaaaacagtctatactggaacaagagcaattgtaaggactttgccatctggtcat
ataggaatggttgcctcgaactctattgaccggtcgaaaacccataatgagttaaggcac
tgcagggttacatcagatcagctggtaacatttcaaatttcaagaagccaggcattacgt
tcttatcttctgcagtctatatggcatgagatcttcaaaacagcaacaggatcagaagat
tctttgaaatattttctccatccggtaaaggaaccactaacgccacagcgccatacagat
tgctggtgtgaaagagacaacttgtgcataaaatcatgtatacaagcttctgaatactgt
gccactttacacaggacttctctttcaaactttgtcagcggtgctttactagaagcaacc
acatcattgggggcaagaagtggttcgctaaatatcttaggaggatcaactggaaagacc
atgctaaaagaacgaaaattgagttcatctatggctggatcaaatgtccttacttctgct
gtagctggtatcagcaaagagcttgtagatctgcagcatctcattcagtttcccgaggag
gttgctagcattctgactgagcaagagcaggatctttacagaaaagtattgcccattgac
tacctctgcttcttaaccagagatttggggaatgctgagtgccagaacaaactttcaact
attaaagcttcaatttctgcaacacttctttcagcttcaaatggggaacacagtgctgtt
gaagatctagtgacaagattcaatgaggtgagttcttgggtgacatggctgattctgaca
gcaggctctatggaagaaaaacgagacgtcttctcttatgtagtccatgtggcaaaatgc
tgctggaacatgggcaactacaacgctgtcatggagttcttggcaggactaaggtcaaga
aaagttttaaaaatgtggcaattcatggaccagtctgatattgaaacgatgcggagcttg
aaagatgctatggcacagcatgaatcatcctccgaatacagaaaagttgtcaacagagct
ctgaatatacccggctgtaaagttgtccctttctgtggtgtctttttaaaagaactctgt
gaagttttggatggggctgcaagtctcatcagactttgtcctcaatataactctcaggat
gaaacactggagtttgttgcagaatataatgggcaagataactatttgcagcgggtaggc
cgagatggcttacatagcgtggaaaaggaatcagcagctaactacatatttcagacgatt
cggagctgcaatcggagtttggaatctgaagatggagaagataattttattgaagatgaa
ggtggaagttccagaagaaattctttgaaggacagaaaccgctatctgtttataactgga
gatctatcagattctgaaagcgatctttttgagcaatccagagaatggaccccaccagca
gctgaagagcagcagcaagcattctgccatggaatagaactcattccttggtatgttctg
tcaattagagctgatgtccatcagttcctgctgcaaggtgcaaccgtcatacattatgac
caagaaacacatttttcagcacgatgttttcttcagcttcaacctgataatagtacattg
acatggacgaaacctaccactgcttgctgtacaaattcaaaaatgagactaaatatgctc
ggtaccactgctgaacttgggaaatttcaatttcttggcaatactggaataaatggattg
gtggagggctgcttagacctgttctcagcaaaggcagtgtatatggggcactctggcatt
gatatgcattctgtgtgcattcagaataaactttgtaatatgtctcttgaagagaatggt
gtgacactattatatggacttcaaactactgaaaataagttgctgcactttgtagctcca
aaatatactgccaaaatgctttttgatggattgctggaattaatttgtgctacaaggaag
atgaagaaattccctgatcagagactacaatggctgcgaaaacaatatgttagcctttac
caggaggacagccgatatgaaggcccaaccttggcccaagctgttgaattatttggaggg
agacgctggagtacgagaaacacaagcccaggaaacctgatgaaaaatgtagagaaacca
ggtgtgcaaagaaacaacactcttggaatcaatacagccaagaaaaagaagaaagtactc
atgaggggtgaaagtggagacggcactgatgatgagatgacaactcgaaaagcaagaact
tttaaggaaaatcggagcagaagcggttcagaccctcaggatattgatgagcaagaggat
gcagaaccatctcttctggttacttttttgggtaccaacaccctgccttccagaagatca
cagtctctgactacctcagcgccacctaatgtaacacctggggtctcacctgtcaggcca
gtatcttctcctgtgatgtcgtcatcaataaagagtcaatctagcacgtggagcagcagt
agctggcatggaagagttaaagggggattgaaggggttccaaacttgcatggtttctgat
aacaacatgagttttgttgaatttgtagagctcttcaaatctttcagtgttcgtagccgc
aaagatttaaaggatctttttgatgtttatgcggtcccctgcaatcgattgggttcagat
tctgctcctttgtatacctccctgaagattgatgagaacacaaatggactccagcctgat
ttagatttgctaacaaggaatatatcggatttgggtttgttcattaaaaacagacagcag
ctatcggacaaccagcgacaaatatctgatgccattgctgcagccagtattgtaactaat
ggcactggagtagagagtacatctctgggaatctttggtgtgggcattcagcaactcaat
gacttcttagtaaattgccaaggagaacactatacatatgatgaactcctcagtattatt
cagaaatttgagcccagcatcaacatgtgtcagcagggactaatgtcatttgaaggattt
gcacggtttctgatggataaagataattttgcatctttgaacaatgaatctcaggagaac
atagatgttttggtatttccactgtcatattactacattgagtcctcacacaatacgtat
ctcacaggacaccagctgaaaggagaatcttcagtagaactttacagccaggttctcttg
caagggtgtaggagcgttgaattagactgctgggatggggatgatggaatgccagttatt
tatcatgggcatactcttactactaagattccttttaaggaagtggttgaagccattgat
cgtagtgcctttttcacctcggacatgccaatcattatatctattgagaaccactgttcc
ttacctcagcaacgaaaaatggctgacattttcaagaatacgtttggagaaaagcttgta
actaagtttttatttgaaagtgatttttctgatgaccctatgctgccttctccccttcaa
ttgagggggaaaattctgcttaaaaacaaaaagctcaaagcacatcaaactccagtggat
atattaaaacagaaggctcatcagctggcacacatgcaagctcaggcaagtaatggtagc
aatgtggtgaatctttctactccaaatgaggaagaagaggatgaggaagatgaatatgac
tatgactatgaatctctttctgatgctgatgtccttaatgcttctcctgctcctaactgc
caggaagataacattctggaagaccgacctgagaataagttaaccatcgataaactccag
tttgaatactgtgaagaaactgccaaaagaatcaagaagatggacagtgccatatacaat
aataaaggaaagatttatgacatggaattaggtgaagaattctatctctctcaaaataaa
aaagaaagtagacagatagcgcccgaactgtcagatcttgtcatctactgtcaagctgtg
aaattccctggcctgtcgactctaaatccatctggctctagcagagggaaagaaagaaag
agcaggaagtccatttttggcaacaatcctggaagactgagccctggggagccagcaata
cttgccaaggcatctggaaaaggcgcctttgacagtgcacggcagaactgggaagaagct
tgtcctcctacttttagccctacaacttctctcagttctataatcaggactcctcgatgt
taccatatctcctctttgaatgaaaatgccgccaagcgcttatgcaggcgatactctcag
aagctgatccagcacaccacttgccagctgttgagaacatacccggctgctacgcgcatt
gattcctccaatcctcacccacttctcttctggcttcacggagtacagctagtggcactg
aactatcaaacggatgatcttcccttgcacctgaatgcagcaatgtttgaatcaaatggt
ggctgtggatacgttctgaagcctcctgtcttgtgggacaggaattgcccgatgtaccaa
catttttgtcctttggaaagagatttagacaatatggaaccagctatttattcattaaca
attgtgtctgggcagaacgtttgtcccagcaatagcacaggaagtccatgcattgaagtg
gatgtgcttgggatgcctctggatagctgccatttccggacgaagcccattcatcgcaat
actctcaatcccatgtggaatgagcagttcctattccggatccactttgaggatctggta
ttccttcgctttgcagttgttgaaaacaattcctcagctgtcatggctcaaagaatcatc
ccactgaaggctctgaagagaggctacagacatctccagctacgaagcctgcacaatgaa
gcactagaaatctcaagtttgttcattaacagccgaagaatggaagaaaactcttctgga
attgctattccttcttctttgcggtttagcacacctgagaggaggtcggctgctctctac
aaagttaccatacatggagtcccaggtccagaaccttttacactttttactattaggcaa
ggaaccacagttgctcagcttctgcatcaaattttggttgccacaaaaagcattggaacg
tatcctgcagattatttcttgatggaggagaagtgctttatatccaaagaaaggaatgaa
tacaggaaaccaccgttccagagactccttggccccgaggaggagattgtccagctcctg
aatagctggttcccagaagaaggttatgttggaaggatcctctttaaaacacgcgaggaa
aacttgaacgggagaaatctctttcaggaagagaaggaagatgctgttgctagctctgag
gatgacagtttctttgtccaagtgcatgacgtttccccagaacagccgcgaacagttatc
aaagctccccgcttcagcacagcccaggatgttatccagcagactttatgcaaggccaaa
tactcctacagtattctgagcaatcccaacccaagtgattatgtgctcttggaggaagtg
acgaaagagtcaacaagcaaaaaatcttctgcatccaaaacatctcagaggattctttct
gatcaagaatgtgtgtttcaggctcagaacaagtggaagggagctgggaaatttatcctt
aaacttaaagaacaagttcaaacaggccgagatgacaaaaggaaaggcatttcatttgct
aatgaacttaagaaattaactaaatcaagtaagcaatacagaggctttatcacttcgcct
cttcaaacatcttcagaaagtctcccaagtaaaaatgacaagacggcttgcggtttgact
ttcagtgacactatggagtaa

DBGET integrated database retrieval system