KEGG   Anolis carolinensis (green anole): 100552084Help
Entry
100552084         CDS       T01608                                 

Gene name
stambpl1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100552084 (stambpl1)
Peptidases [BR:acs01002]
 Metallo Peptidases
  Family M67
   100552084 (stambpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 448 aa AA seqDB search
MEGLERNSKPSLPAPSNMEQPITVSSLKRLAAVPDHTDVSLSPEERVRALSKLGCNITIN
EDITPRRYFRSGVEMERMASVYMDEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEK
QDILKKLKDVAFPRTDELKKALLKKYNAEYQEYMQDKNKCKSELLKKLEQQQLIDAEKKR
IAQLRQQQLETEQFQFFEDQLKKQELARDLKTKDGSAMSEQTDGSVLSSCISAHLNSAFS
TTKANKSDASAGQSPPISRALKPAATLSAVQNNVAEGLRSVVLPRDLCHKFLLLAEANTV
RGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFSVQDQHDLLTLGWIHT
HPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGVFRLTNAGMLEVSACKKKGFH
PHTKDPRLFNMCKHIIGKDVNITVLDLR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaaggactggaaagaaacagtaagcctagtctgccagcgccaagtaacatggagcag
ccaatcactgtgagttccttgaaaaggctagcagctgtacctgaccacactgatgtttcg
ctgagcccagaagagcgtgttcgtgccttaagcaagcttggttgtaacatcacaataaat
gaagacattacaccacggcgctactttcgatctggagtggagatggagcgcatggcatct
gtatacatggacgaaggaaatcttgaaaatgcctttgttctctacaataagtttataact
ttgtttgtagaaaagctgccctctcatcgagactaccagcaatgtgcagttccagaaaaa
caggatattttgaagaaactgaaagatgtagcatttccaaggacagatgaactaaagaag
gctctgttaaagaaatacaatgcagaataccaggaatatatgcaagacaagaacaaatgc
aaatctgaattactaaagaagctggagcaacagcaattgattgatgcagagaaaaaacgg
attgcgcagttacgtcaacagcagctggagacggaacaatttcagttctttgaagatcag
ttgaagaaacaagaattagcccgtgatctgaaaacgaaggatggttcagctatgtctgag
cagactgatggaagtgtactgtcatcatgcatttcagcacatctgaacagtgctttctcc
acaacaaaagcaaacaagagtgatgcctctgctggtcagtctcctcctataagtcgggcc
ttaaagccagctgctacactaagtgctgtacagaacaatgtggctgaagggctacgaagt
gtggtactgccaagggatctttgtcacaaatttctgctgctagcagaggcaaatacagta
agaggaatagagacatgtgggattctctgtggaaaactgacccataatgaattcactatt
actcacgtgatagtgccaaagcagtctgctggcccagactactgtgacatggagaatgtg
gaagagctgttcagtgtccaagatcagcatgatctcctcacattgggctggatccataca
catccaacacagactgcatttttatctagtgttgatcttcacacacattgttcttatcag
ctaatgctaccagaagctattgcaattgtttgttcaccaaaacataatgacacgggagtc
ttccgacttactaatgctggtatgttggaagtttctgcttgtaagaagaagggctttcat
ccccataccaaggaccctagactatttaatatgtgcaaacatatcattgggaaagatgta
aacataactgtattggatctgaggtga

DBGET integrated database retrieval system