KEGG   Anolis carolinensis (green anole): 100552100Help
Entry
100552100         CDS       T01608                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100552100
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100552100
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100552100
  Exosomal proteins of colorectal cancer cells
   100552100
  Exosomal proteins of bladder cancer cells
   100552100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 468 aa AA seqDB search
MEALLLALLLAALAPRPGGASDVIELGDDDFDSGLSDRSVALVEFYAPWLVSRPEGERGG
DGRAERGAPRRLRASTLRGAPEYGIVSHLKKQAGPASVALRSDTFEKFISEKDAAVVGFF
KELFGDAHSEFMKAASNLRDNYRFGHTSDEELIKKYEPDGEGIFLFRPLHLANKFEENSV
RYTEDKITTGKIKKFLQENIFGLCPHMTEDNKELIQGKDLLVAYYDVDYEKNPKGSNYWR
NRVMKVARSFLDAGHKLNFAVASSKTFGHEISEFGLDSSTSDVPVVALRTAKGEKYAMQE
EFSRDGKALERFLQDYFDGNLKRYLKSEPIPENNEGPVKVIVAENFDEIVNAEGKDVLIE
FYAPWCGHCKNLEPKYKELGEKLSNDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPAGS
KQNPKKYEGGREVSDFVSYLKREATYPPVLQEDEKPKKKKKAAPKEDL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaggccctgctgctcgcgctgctcctcgccgccctcgcgcccaggccgggcggggcc
tccgacgtgatcgagctcggcgacgacgacttcgacagcggcctttcggaccgcagcgtc
gccttggtcgagttctacgcgccgtggttggtttcgaggcctgaaggggaacgagggggg
gacgggagggctgagcgcggggctccgaggcgactcagggcctcgaccctcaggggcgcc
cccgaatatggaattgtgagccatctcaagaaacaggccggtcctgcctcggttgcccta
cgatctgatacgtttgagaagttcatcagcgaaaaggatgctgcggtagtgggcttcttc
aaggagctgtttggtgacgctcactccgagttcatgaaagcggcaagcaacttgcgggac
aactaccgctttgggcacaccagcgacgaagagctgatcaagaagtatgagccggatggc
gagggaatcttcctgttccgtcctctgcacctggccaacaaatttgaggagaactctgtt
cgatacacggaagacaagatcaccactggcaagatcaagaagttccttcaggagaacata
ttcggcctctgcccgcacatgacggaagacaacaaagagctgatccaaggaaaggacctg
cttgtggcgtattacgacgtggattacgaaaagaatcccaaagggtcaaactactggcgg
aacagggtgatgaaagtggcccggagtttcctggatgctgggcacaagctcaactttgcc
gttgccagttcaaagacctttggccacgagatctcggagtttggcctggacagctccacc
agcgatgtccccgttgtggccctcaggacggccaagggggagaagtacgccatgcaggag
gagttctcgcgtgatgggaaggccttggagagattcctccaggattattttgatgggaac
ctgaaaagatacttgaagtccgaacccatcccagaaaacaatgaggggcctgtgaaggtg
attgtggctgagaactttgatgagatagtcaacgcggaaggcaaagatgtccttatagag
ttctatgcaccatggtgtggccattgcaagaacctggagcccaagtacaaagagctaggg
gagaagctcagcaacgatcctaacattgtcattgccaagatggacgccacagccaacgat
gtgccttctccctacgaagtccgagggttccccaccatttacttttctcctgcgggaagc
aagcagaatccaaagaaatatgaggggggccgtgaggtgagtgactttgtcagctacttg
aagcgggaggccacctacccgcctgtcctgcaggaggatgagaaacccaagaagaagaag
aaggcagcgcccaaggaagatctgtga

DBGET integrated database retrieval system