KEGG   Anolis carolinensis (green anole): 100552100Help
Entry
100552100         CDS       T01608                                 

Gene name
pdia3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100552100 (pdia3)
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100552100 (pdia3)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100552100 (pdia3)
  Exosomal proteins of colorectal cancer cells
   100552100 (pdia3)
  Exosomal proteins of bladder cancer cells
   100552100 (pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 613 aa AA seqDB search
MVSRDPFQLPDPLIAGGGRGRASGKSAALGVALATRRGPAPTRRGTPRLVASPQAPANER
LPHCRSGLSSGGGRTSGRSFSFPLRRASATESESRRRRRLSLRLARPLRLRVSMEALLLA
LLLAALAPRPGGASDVIELGDDDFDSGLSDRSVALVEFYAPWCGHCKRLAPEYESAATRL
KGVVPLVKVDCTANSNTCNKYGVSGYPTLKIFRNGEESGTYDGPRTADGIVSHLKKQAGP
ASVALRSDTFEKFISEKDAAVVGFFKELFGDAHSEFMKAASNLRDNYRFGHTSDEELIKK
YEPDGEGIFLFRPLHLANKFEENSVRYTEDKITTGKIKKFLQENIFGLCPHMTEDNKELI
QGKDLLVAYYDVDYEKNPKGSNYWRNRVMKVARSFLDAGHKLNFAVASSKTFGHEISEFG
LDSSTSDVPVVALRTAKGEKYAMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPENNE
GPVKVIVAENFDEIVNAEGKDVLIEFYAPWCGHCKNLEPKYKELGEKLSNDPNIVIAKMD
ATANDVPSPYEVRGFPTIYFSPAGSKQNPKKYEGGREVSDFVSYLKREATYPPVLQEDEK
PKKKKKAAPKEDL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggtctcgcgagatcctttccaactcccggatcctctgatagcaggaggagggcggggc
cgcgcttctgggaagagcgctgctctaggcgtcgccttggcgacaaggcgaggccccgcc
cccacccgtcgcgggactccccgattggtcgcgagtcctcaggcgccggccaatgagcgc
ctgccacactgcagatccggcctctcttccggagggggcaggacttccggccgctctttt
agcttcccgctgcggcgagcgagcgccacagaaagcgaaagccgccgccgccgccgcctc
tccctccgcctcgcgcgtcctctccgtctccgggtgtccatggaggccctgctgctcgcg
ctgctcctcgccgccctcgcgcccaggccgggcggggcctccgacgtgatcgagctcggc
gacgacgacttcgacagcggcctttcggaccgcagcgtcgccttggtcgagttctacgcg
ccgtggtgtggccactgcaagcgcctggcccccgagtacgagtcagcagccacccggctg
aagggcgtggtcccgctggtcaaggttgactgcacggccaactccaacacctgcaacaag
tacggcgtgagtggctacccgacgctcaagatcttccgcaacggggaagagtcagggacc
tacgatgggcccaggacggcagatggaattgtgagccatctcaagaaacaggccggtcct
gcctcggttgccctacgatctgatacgtttgagaagttcatcagcgaaaaggatgctgcg
gtagtgggcttcttcaaggagctgtttggtgacgctcactccgagttcatgaaagcggca
agcaacttgcgggacaactaccgctttgggcacaccagcgacgaagagctgatcaagaag
tatgagccggatggcgagggaatcttcctgttccgtcctctgcacctggccaacaaattt
gaggagaactctgttcgatacacggaagacaagatcaccactggcaagatcaagaagttc
cttcaggagaacatattcggcctctgcccgcacatgacggaagacaacaaagagctgatc
caaggaaaggacctgcttgtggcgtattacgacgtggattacgaaaagaatcccaaaggg
tcaaactactggcggaacagggtgatgaaagtggcccggagtttcctggatgctgggcac
aagctcaactttgccgttgccagttcaaagacctttggccacgagatctcggagtttggc
ctggacagctccaccagcgatgtccccgttgtggccctcaggacggccaagggggagaag
tacgccatgcaggaggagttctcgcgtgatgggaaggccttggagagattcctccaggat
tattttgatgggaacctgaaaagatacttgaagtccgaacccatcccagaaaacaatgag
gggcctgtgaaggtgattgtggctgagaactttgatgagatagtcaacgcggaaggcaaa
gatgtccttatagagttctatgcaccatggtgtggccattgcaagaacctggagcccaag
tacaaagagctaggggagaagctcagcaacgatcctaacattgtcattgccaagatggac
gccacagccaacgatgtgccttctccctacgaagtccgagggttccccaccatttacttt
tctcctgcgggaagcaagcagaatccaaagaaatatgaggggggccgtgaggtgagtgac
tttgtcagctacttgaagcgggaggccacctacccgcctgtcctgcaggaggatgagaaa
cccaagaagaagaagaaggcagcgcccaaggaagatctgtga

DBGET integrated database retrieval system