KEGG   Anolis carolinensis (green anole): 100552191Help
Entry
100552191         CDS       T01608                                 

Gene name
tmx3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 455 aa AA seqDB search
MGAARGGRRSLLWAAVTAVILVVDASYVHDLDDSFKENRKDDIWLVDFYAPWCGHCYTLE
PVWNEVGKEMGGTGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKE
DIVEFANRVAGPIIRPLPSQQMFDHVQKRNRVFFLYVGGESPLKEKYIEVASELIVYTYF
FSATEEVLPEHITLPEMPAVLVFKDATYFVYDEYEDGDLSSWISRERFQGYLNVDGFTLY
ELGDTGKLVAIAIIDDKNTSTDHTRLKLIVQDVARNYRDHFNRNFQFGHMDGNEYINSLL
MDDVKIPSIVVLNTSNQQYFLPHKPIESTEDMVQFINEILEGTAEAQGGDGILQRIRRII
YDAKSTVGSVFKSSPLLGCFLFGLPLGVISIMCYGICTADTDGGSDEAEMPKRETGRDLT
DEGTEEEQEEESGESHVEYTDGEQEQKPILEKKKD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgcgaggggagggcggaggagcctcctctgggcagcagttactgcagtcata
cttgttgtagatgcttcttacgtgcacgacttagatgactcgtttaaagagaaccgtaaa
gatgacatctggcttgtagatttctatgcaccttggtgtggccactgctatacactggag
ccagtgtggaatgaagttggtaaagagatggggggcactggttctccagttaaagttgga
aaaatggatgcaacttcttattctagtattgcctctgaatttggagttcgaggctatcca
acaattaaattgctaaagggtgacttggcatacaactatagaggccctagaaccaaggaa
gatattgttgaatttgcaaacagagtagcaggccctattataaggccactccctagccag
caaatgtttgatcatgtgcagaagaggaatcgtgttttttttctgtacgttggtggggaa
tccccattgaaggaaaaatacatagaagttgcttccgaactaattgtttatacatacttt
ttttctgccacagaagaggtactaccagagcatataacacttcctgagatgcctgctgtt
cttgtctttaaagatgcaacatatttcgtatatgatgaatatgaagatggagatctgtca
tcctggataagcagagagagatttcagggatatcttaatgtagatggatttacactctat
gaacttggagacacagggaaactagtggctatcgcaattattgatgataaaaatacttct
acagatcatacaaggttgaagttaattgttcaagatgttgcgaggaattacagagaccat
tttaataggaactttcaatttggccacatggatggaaatgagtatattaatagtttacta
atggatgatgtgaaaatccccagtatcgtcgtcctaaacacatccaaccaacagtatttc
ctacctcataaacctatagagagcactgaagatatggtccagttcattaatgagatcttg
gaaggcactgcagaagcacaaggtggagatggaattcttcagcgaatcaggagaataatt
tacgatgccaagtcaactgtgggatctgttttcaagagttccccacttttgggctgcttt
ctctttgggctgccactgggtgtcatcagcatcatgtgttatggaatctgcaccgctgac
actgacggtggatcagatgaagcagagatgcctaagagagaaacaggcagagatctgaca
gatgaaggcactgaagaggaacaagaggaggagagtggtgaaagccatgtagaatacaca
gatggtgagcaagaacagaagcctatattggaaaagaagaaagactaa

DBGET integrated database retrieval system