KEGG   Anolis carolinensis (green anole): 100552247Help
Entry
100552247         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 45-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100552247
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100552247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 811 aa AA seqDB search
MRVKDPSRVVSDRSKRHKKSNHPQDEDSSDDIAVGLTCQHVSQAVDVHNVKRTVAQNLWL
VCTECLKERRICDGEPVMPSDIWLCLKCGIQGCSQNSEGQHSLKHFQTAQVEPHCIVINL
STWIVWCYECNEELSTHCNKKALAQIVDFLQRHVARNESSSSSKVIWLHEENNEANDILK
GKGVNSSWASVPVKGINNLGNTCFFNAVMQNLAQTHMLNEXMKEKGTKLKIGQNPASQLD
PLVVNLSSPGSLTSAMFLFLHSMKEIGKGPLSPKVLFNQLCQKAPRFKGYQQQDSQEVLH
YLLDAMRIEETKRVQAAILKAFNNPTTKTADEETKRKVKAYGREGVKMNFIDRIFVGELT
STIMCEECENISTVKEPFIDLSLPIIEERISKPVPFGRTSKSKTDIDQYSCSSINSLNNQ
QSKLSRKQTKDKNQVNHEKRLTKRSSSGEEETIPFIMQEEIGHNKAEGRAKGSYARNSNT
AIDSGANGSPIEGSEKEASHSESSMDADSEASESETASSRACCTPGLCTIEHKHIPGNIT
LQYNNSDCSNTDMVTDALSKLCFSNRANESVGSLHKDPLSSPSNNFSAESTLLVQGPQNA
FQTLSQSYTTSSKECSVQSCLYQFTSVELLMGNNKLLCENCTDRKQKYQKKSNTIEKKTE
GVYTNARKQLLISSVPAVLVLHLKRFHQAGVSLRKVNRHVDFPLVLDLAPFCSAFCKNVT
DGGKVLYALYGIVEHSGSMRGGHYAAYVKVRSPSKKLLEHISSNKNVQGLKESGGASIGQ
WVFVSDTHVQAVPESRVLNSQAYLLFYERML
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaaaagatccatcaagagtagtctctgacagaagtaagaggcacaaaaagtca
aatcatccacaggatgaagactcttccgatgatatagcagtgggccttacgtgccagcat
gtaagtcaggcagtagatgtgcataacgtgaagaggacagtagctcaaaatctttggtta
gtatgtacagagtgcttgaaggaaagaagaatatgtgatggtgagcccgtaatgccttct
gacatatggctctgcctgaaatgtggcattcagggctgcagtcaaaactcagaaggccag
cactctctaaagcattttcaaacagcacaggtagaacctcattgcattgtaatcaatctc
agcacatggattgtatggtgttatgaatgtaatgaagagctgtcaacacactgtaacaag
aaggctttggcgcagatagttgatttcctccaaagacatgttgctagaaatgaatcaagt
tcatcctcaaaagttatatggctacatgaagaaaacaatgaagcaaatgatatattaaag
gggaaaggcgtaaattccagctgggcatctgttccagttaaaggcattaataatttagga
aatacatgcttctttaatgccgtgatgcagaatttggcacagacacacatgttaaatgaa
nnaatgaaagaaaaggggacaaagctaaaaattggtcagaatccagcatctcaactggat
cctttggtagtgaatctttcaagtcctgggtcactgacatcagctatgttcctgttcctt
cacagcatgaaagaaataggaaaaggacctctttctcccaaagttcttttcaaccagctc
tgtcaaaaggctcctcggtttaagggatatcaacagcaagacagccaagaagttctccac
tatttgctggatgcaatgagaatagaagaaacaaagcgagtacaagctgcaatcttaaaa
gcgttcaataacccaaccaccaaaacagcagatgaagagacaaaaagaaaagtcaaagcc
tatggaagagagggtgttaagatgaacttcatagataggatctttgttggtgaattgaca
agcactatcatgtgtgaggagtgtgaaaacatttccacagttaaggaacctttcattgat
ctttcgctccctattatagaagagaggatctcaaaacctgttccttttggaaggacaagc
aaaagtaaaacagatattgatcaatacagctgttcttctattaattctctgaataaccaa
caatcaaaactatctaggaaacaaacaaaggacaagaaccaggttaaccatgagaaaaga
cttaccaagagatcctcctctggtgaagaagaaacaattccttttattatgcaggaagaa
attggccataacaaagctgaaggaagagctaaaggttcatatgcaagaaacagcaataca
gccatagattcaggagcaaatgggagcccgattgaagggagcgaaaaggaagccagccac
tccgaaagcagcatggatgcagatagtgaggcctctgaaagtgaaacagcttccagtaga
gcttgctgtacacctggtttgtgcaccattgagcataaacacatacctggaaacattaca
ttgcagtacaacaattcagactgtagcaatacggacatggtcacggatgccttgtcgaaa
ctgtgcttcagcaacagagccaatgaaagtgtggggtctttgcataaggatcccctatca
agcccgtcaaataacttttcagcagaaagcaccctattagtgcaaggcccgcaaaatgct
ttccagaccctgtcgcagagctacaccactagttccaaagagtgttctgtgcagtcatgc
ctctaccagtttacctctgtggaactgctaatgggaaacaacaagcttctctgtgagaac
tgcacagaccggaaacagaagtatcaaaagaaatcaaataccattgaaaagaaaacagaa
ggtgtgtacacaaatgccaggaagcagctgttgatttcttctgttcctgctgttcttgtt
ctccatctgaaaagattccaccaggctggtgtgagtctaaggaaggtaaatcgccatgtg
gattttccactagttctggacttggctccattttgttctgctttttgcaagaatgtgaca
gatggtgggaaagttctctatgccctttatggaatagtggagcacagtgggtcaatgcga
ggaggtcattatgcagcatatgtgaaagtcagatcaccatcaaaaaagcttttggaacac
atttcaagcaataaaaatgttcaaggtttaaaggaatcaggaggagcatctataggacag
tgggtctttgtcagcgatacccatgtacaagcagttcctgaatcaagagtcttgaattca
caagcttatttacttttctatgaacgaatgttgtag

DBGET integrated database retrieval system