KEGG   Anolis carolinensis (green anole): 100552257Help
Entry
100552257         CDS       T01608                                 

Gene name
tyr
Definition
(RefSeq) tyrosinase
  KO
K00505  
tyrosinase [EC:1.14.18.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100552257 (tyr)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100552257 (tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100552257 (tyr)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100552257 (tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 527 aa AA seqDB search
MCLFSIGIFFGLLPLGLSQFPRACANSDSLLKKECCPPWPGDGSPCGELSGRGSCSDILL
SDAPLGPQFPFSGVDDREDWPAVFYNRTCQCTGNFMGFNCGDCKFNFAGPNCTQRKAQVR
RDIFRISAREKFQFLAYLNLAKHTTSRDFVIATGTYAQMNNGSTPMFRDINVYDLFVWMH
YYVSRDTLLGGTSVWRDIDFAHEAPGFLPWHRLFLLMWEHEIQKLTGNENFTIPYWDWRD
AQGCDICTDEIMGGRHPSNPNILSPASFFSSWQVICSRSEEYNSRQELCNGTNEGPILRN
PGNHDKGRTPRLPSSADVEFCLSLTQYEAGTMDKMANFSFRNTLEGFADPSTAISNVSQS
SLHNALHIYMNGSMSEVQGSANDPIFILHHAFVDSIFEQWLRRHRPLREVYPAANAPIGH
NRESYMVPFIPLYRNGEFFISSIELGYDYEYLTNPANPFQNFFLPYLEQARQIWPWLVGA
AVVGAIIMLIVGIIVLRCRKKRRISEETQPLLMESEDYQHMTYQSHV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttttctccatcggcatcttcttcggtcttcttcctctaggattgagccagttc
ccacgggcatgtgccaattcggacagtctgctaaaaaaggaatgctgccccccttggcca
ggggacgggtctccttgtggagagctttcaggcagggggtcctgttcagatatccttctt
tcagatgccccacttggtcctcagtttcccttctctggagtggacgacagggaagattgg
ccagctgttttttataacagaacttgccaatgcacaggcaacttcatggggttcaactgc
ggcgattgcaagttcaactttgcaggtcccaactgcactcaaagaaaggcacaggtgagg
agagatatcttccggatcagtgccagggaaaagttccagtttcttgcctacctcaatttg
gccaagcacacaactagccgggattttgtcattgcaacaggaacgtatgctcaaatgaac
aacggctcaacccctatgttccgagacatcaacgtctatgacctgttcgtttggatgcat
tattacgtgtcccgggatacgctccttggaggcaccagcgtgtggcgagacattgatttt
gcccatgaggccccaggtttccttccttggcaccggctttttttgctcatgtgggaacat
gagatccagaagttgactgggaatgagaactttaccatcccctattgggactggcgagat
gcccagggctgtgacatctgtacggatgaaatcatgggtggcagacatcccagcaaccca
aacattctgagtccagcttctttcttctcttcatggcaggtaatttgcagccggtcagaa
gagtacaacagtcgtcaagaactttgcaatggcacaaatgaagggcctattcttcgaaac
cccggcaaccatgataaagggaggacacctcggcttccatcttcggcagatgttgaattc
tgcttaagtttgacacagtacgaagcgggaaccatggacaaaatggctaacttcagcttc
aggaatactttggaaggctttgctgatccgagtactgcaatatcaaatgtatctcaaagc
agcctgcacaacgcattgcacatctacatgaatggctccatgtctgaggtacaaggatca
gccaatgatcccatcttcatccttcaccatgcctttgttgacagcatttttgaacaatgg
cttagaagacatcgacctctacgtgaggtttatcctgcagccaatgccccaattggacac
aaccgtgaatcctacatggtccccttcattccactttacaggaatggggaattcttcata
tcatcaatagaactgggatatgactatgaatatctaacaaatccagccaaccccttccag
aattttttcctgccttatttggaacaggcacgtcaaatctggccatggctggtgggagct
gccgtggtgggtgccattataatgttgattgttggcatcattgttctacgatgtcggaag
aagagacggatctcagaagagacacaaccattactcatggagagtgaggattatcagcac
atgacataccagtcacatgtataa

DBGET integrated database retrieval system