KEGG   Anolis carolinensis (green anole): 100552257Help
Entry
100552257         CDS       T01608                                 

Definition
tyrosinase-like
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:acs00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:acs00740]
Organismal Systems; Endocrine system; Melanogenesis [PATH:acs04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 527 aa AA seqDB search
MCLFSIGIFFGLLPLGLSQFPRACANSDSLLKKECCPPWPGDGSPCGELSGRGSCSDILL
SDAPLGPQFPFSGVDDREDWPAVFYNRTCQCTGNFMGFNCGDCKFNFAGPNCTQRKAQVR
RDIFRISAREKFQFLAYLNLAKHTTSRDFVIATGTYAQMNNGSTPMFRDINVYDLFVWMH
YYVSRDTLLGGTSVWRDIDFAHEAPGFLPWHRLFLLMWEHEIQKLTGNENFTIPYWDWRD
AQGCDICTDEIMGGRHPSNPNILSPASFFSSWQVICSRSEEYNSRQELCNGTNEGPILRN
PGNHDKGRTPRLPSSADVEFCLSLTQYEAGTMDKMANFSFRNTLEGFADPSTAISNVSQS
SLHNALHIYMNGSMSEVQGSANDPIFILHHAFVDSIFEQWLRRHRPLREVYPAANAPIGH
NRESYMVPFIPLYRNGEFFISSIELGYDYEYLTNPANPFQNFFLPYLEQARQIWPWLVGA
AVVGAIIMLIVGIIVLRCRKKRRISEETQPLLMESEDYQHMTYQSHV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttttctccatcggcatcttcttcggtcttcttcctctaggattgagccagttc
ccacgggcatgtgccaattcggacagtctgctaaaaaaggaatgctgccccccttggcca
ggggacgggtctccttgtggagagctttcaggcagggggtcctgttcagatatccttctt
tcagatgccccacttggtcctcagtttcccttctctggagtggacgacagggaagattgg
ccagctgttttttataacagaacttgccaatgcacaggcaacttcatggggttcaactgc
ggcgattgcaagttcaactttgcaggtcccaactgcactcaaagaaaggcacaggtgagg
agagatatcttccggatcagtgccagggaaaagttccagtttcttgcctacctcaatttg
gccaagcacacaactagccgggattttgtcattgcaacaggaacgtatgctcaaatgaac
aacggctcaacccctatgttccgagacatcaacgtctatgacctgttcgtttggatgcat
tattacgtgtcccgggatacgctccttggaggcaccagcgtgtggcgagacattgatttt
gcccatgaggccccaggtttccttccttggcaccggctttttttgctcatgtgggaacat
gagatccagaagttgactgggaatgagaactttaccatcccctattgggactggcgagat
gcccagggctgtgacatctgtacggatgaaatcatgggtggcagacatcccagcaaccca
aacattctgagtccagcttctttcttctcttcatggcaggtaatttgcagccggtcagaa
gagtacaacagtcgtcaagaactttgcaatggcacaaatgaagggcctattcttcgaaac
cccggcaaccatgataaagggaggacacctcggcttccatcttcggcagatgttgaattc
tgcttaagtttgacacagtacgaagcgggaaccatggacaaaatggctaacttcagcttc
aggaatactttggaaggctttgctgatccgagtactgcaatatcaaatgtatctcaaagc
agcctgcacaacgcattgcacatctacatgaatggctccatgtctgaggtacaaggatca
gccaatgatcccatcttcatccttcaccatgcctttgttgacagcatttttgaacaatgg
cttagaagacatcgacctctacgtgaggtttatcctgcagccaatgccccaattggacac
aaccgtgaatcctacatggtccccttcattccactttacaggaatggggaattcttcata
tcatcaatagaactgggatatgactatgaatatctaacaaatccagccaaccccttccag
aattttttcctgccttatttggaacaggcacgtcaaatctggccatggctggtgggagct
gccgtggtgggtgccattataatgttgattgttggcatcattgttctacgatgtcggaag
aagagacggatctcagaagagacacaaccattactcatggagagtgaggattatcagcac
atgacataccagtcacatgtataa

DBGET integrated database retrieval system