KEGG   Anolis carolinensis (green anole): 100552265Help
Entry
100552265         CDS       T01608                                 

Gene name
aldh1l2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
acs  Anolis carolinensis (green anole)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:acs00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 924 aa AA seqDB search
MLSRANQLLRTFSTSARDYYQNKLKLALIGQSVFGQEVYQHLQKEGHKVVGVFTVPDKNG
KADPLAFAAEKDGTPVFKFPRWRVKGKTIPEVIDAYKSVGAELNVLPFCTQFIPMDVIDN
PQHGSIIYHPSILPRHRGASAINWTLIHGDKKAGFTVFWADDGLDTGPILLQRECDVGPN
DTVDDLYNRFLFPMGIKAMVEAVQLIADGKAPRIPQSEEGATYEGIQKKENAEIPWDQPA
SALHNWIRGHDKVPGAWATIDGQMVTFYGSSLLEGSAPPGEELAIKGAAKPGLVTKNGLV
LFGNDEKMLLVRNLQFEDGRMIPASKYFSTDDLSAIELTVEEKKMAEDIKSIWKGILTNV
AVLEDTTDFFKSGASSMDVVRMIEEIKQKCAGLELQNEDVYMAPKFGDFIQLAVRRHRGE
DKEEELIIDYVSKEVNNMTVKMPYQCFINGQFVDAEDGKTCDSINPTDGSVIAKVSLPTV
GDVDKAVAAAKDAFEFGEWGRMNARERGRLMYRLADLMEEHQEELATIETIDSGAVYTLA
LKTHIGMSVQTFRYFAGWCDKIQGSTIPINHARPNRNLTYTKKEPLGVCAIIIPWNYPLM
MLAWKSAACLAAGNTLVLKPAEVTPLTALKFAELSVKAGFPKGVINILPGTGSVAGQRLS
EHPDIRKLGFTGSTPVGKQIMKSCAATNLKKVSLELGGKSPLIIFNDCDLDKAVRMGMGS
VFFNKGENCIAAGRIFVEESIHDEFVRKVVEETSKMKIGDPLDRSTDHGPQNHKAHMEKL
LKYCETGVKEGATLVRGGRQVCRPGFFMEPTIFTDVEDHMYIAREESFGPVMVISKFKDG
DVDGVLERANRTEYGLASGVFTKDINKALYVSDKLDAGTVFINTYNKTDVAAPFGGFKQS
GFGKDLGEEALHEYLRTKAVTVEY
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgctctccagagccaaccaactgctgaggacattctccacctcggccagggattactac
caaaataaactaaagctagctttaataggccagagcgtttttggacaagaagtgtaccag
cacttacaaaaagaaggacacaaagttgtcggagttttcacagtcccagacaaaaatgga
aaggctgatcctttggcctttgctgcagaaaaggatggaacaccagtgtttaaattccca
cggtggagagttaagggcaagactatcccagaagtcatcgatgcctataaatcagtcggg
gctgagttgaacgtccttccattctgtacacagttcattcccatggatgttattgataac
ccacagcacggctctattatttaccatccatccatccttccccgccacagaggtgcatct
gccattaattggactttaattcatggagataaaaaggctggctttacagttttctgggca
gatgatggtctagacacaggacccattcttctacagagggaatgtgatgttggtccaaat
gatactgttgatgatctgtacaatcggttccttttcccaatgggaataaaggctatggta
gaagctgtacagctcattgctgatggcaaagctcctcgtatcccccagtctgaagaagga
gcaacttatgaaggcatccagaaaaaagaaaatgcagagattccctgggaccagccagca
tctgctctgcacaactggatccgaggacatgataaagtacctggggcctgggcaacaatt
gacggccagatggttaccttctatggatcctcattactggaaggctcagcacctccgggt
gaagaactggcaataaaaggtgcagcaaaaccaggacttgtaaccaagaatggcctagtt
ctgtttggcaatgatgagaaaatgttgctagtgagaaatctacagtttgaagatggaaga
atgatcccagcatctaaatatttctctactgatgatctgtctgccatagaacttactgta
gaggagaagaaaatggcagaagatataaaatccatttggaagggaattttgactaatgtg
gctgtcctggaggataccactgacttctttaaatctggagcttcctctatggatgttgtt
cggatgattgaagagatcaagcaaaaatgtgctggtcttgaactacaaaatgaagatgtc
tatatggcgcccaagtttggagattttatccaactggctgtcaggagacacaggggagaa
gacaaagaggaggaattaataatcgattatgtttcaaaggaagtcaacaacatgacagta
aagatgccatatcagtgttttatcaacgggcaatttgtggatgctgaagatggaaaaaca
tgtgactctataaacccaacagatggatcagtgattgcaaaagtgtcactccctacggtg
ggcgatgttgataaagcagttgctgcagcaaaagatgcttttgagtttggtgaatgggga
cgaatgaacgccagagaaagagggaggttaatgtacagacttgcagacctgatggaagaa
caccaagaggaactggcaaccattgaaactattgattcgggagccgtttacacacttgct
ctgaagacccacatcgggatgtcagtgcaaacgtttcgatactttgctggatggtgtgac
aagatacagggttctaccatcccgataaaccatgcacgtccaaatcgtaatttaacttac
accaagaaagaacctttaggagtctgtgcaattataattccttggaattaccctctgatg
atgcttgcctggaagagtgccgcatgtttagcggctggcaatactttggttctgaaacca
gcagaggtcactccactgactgcattaaagtttgcggagctctctgttaaagcaggattt
cccaaaggtgtcataaatattctacctggaacaggtagtgtagcaggacaacgcttgtca
gaacacccagatattcgtaaacttggtttcactggctcaacaccagttggaaaacagata
atgaagagttgtgctgccaccaacttgaaaaaggtttctctagaactgggtggaaaatct
ccattgatcatatttaatgactgtgatcttgacaaagcagtgagaatgggcatgggatca
gttttcttcaataaaggggagaattgcatcgcagctgggaggatttttgtggaagaatca
attcatgatgagtttgttaggaaagtggtggaggaaaccagcaagatgaaaattggagat
ccactagatagatctacagaccatggtccacaaaatcataaagcacacatggaaaaactt
ttgaagtactgtgaaactggagtgaaagaaggagctacactagtccgtggaggacgacaa
gtatgtagaccaggttttttcatggaacccaccattttcacagatgttgaagaccatatg
tatattgcacgtgaagaatcttttggtcctgtaatggtaatttccaagttcaaagatggg
gatgttgatggggtattagaacgagccaacagaacagaatacggtctggcttcaggagtt
ttcaccaaagacattaacaaagctctgtatgtcagtgacaaactagatgctggaacagtt
ttcatcaacacctacaataaaactgatgtggcagctccatttggtggatttaagcaatct
gggtttggaaaagatctaggtgaagaagctcttcatgaatatttgagaacaaaagcagta
acggtggaatattaa

DBGET integrated database retrieval system