KEGG   Anolis carolinensis (green anole): 100552330Help
Entry
100552330         CDS       T01608                                 

Gene name
clock
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100552330 (clock)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100552330 (clock)
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100552330 (clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 887 aa AA seqDB search
MSSIADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMD
KSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDG
SIIYVSESVTPLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTHLLESDSLTPEYLKSKN
QLEFCCHMLRGTIDPKEPPIYEYVKCIGNFKSLSNMPNSAHNGYEETIQRSHRPSYEDRV
CFVATIRLATPQFIKEMSTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAERRRELGIEEALPEIAADKSQDSGSDNHINTVSLKEALERFDRSPT
PSASSRSSRKSSHTAVSDPSSTPTKITVDTSTPPQQNLSNHEKSAQRRASLGNQSINSQP
IGQPLAQPMMPQPATLQIQQGMSQPMLQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEE
LRKIQEQLQMVHGQGLQMFLPQPTPGLNFGSVQLTSGNPSNIQQITPINMQGQVVQTNQI
QGGLNTGHIGSQHMIQQQPLQNTAAQHSQQAILSGHSQQTSLATQSQNALSTPLYNTMVI
SQPAPSNVVQIPSTLQQTNNQNTAITTFGQDRQIRFSQGQQLVTKLVTAPVACGAVMVPS
TMFMGQVVTAYPTFAAQQQQQQPQTLSITQQQQSQQEQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQLTVQQPAQTQLGQHPQQFLQTSRLLHGNQSTQLILS
AAFPLQQSTFTQSHHQQHQSQQQQQQQQQISRHRSDSMSEASKVQPQ
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgagctccattgcagacagggatgatggtagcatttttgatggtctcgtggaagaagat
gacaaggacaaagcaaagagagtatcaagaaacaagtctgaaaagaaacgcagagatcaa
tttaatgtactcatcaaagagctgggatccatgcttccgggcaatgctcggaagatggac
aagtctactgtactgcaaaagagcattgactttttacggaagcacaaagaaatcactgcc
cagtcagatgctagtgaaatccgacaagactggaaacccacattccttagtaatgaagag
ttcacccagttaatgttagaggctcttgatggtttctttctagcaattatgacagatgga
agtataatatatgtatcagaaagtgtaacccccttacttgaacatttgccttctgacctt
gtggatcagagcatatttaattttgtcccagagggggaacattcagaagtttataaaata
ctgtctactcatctgttagaaagtgattcattgactccagaatatttgaaatcaaaaaat
cagcttgagttctgttgccatatgctccgagggacaatagaccccaaagagccacctata
tatgaatatgtcaaatgtataggaaacttcaaatccttaagtaacatgcctaactctgca
cataatggttatgaagaaactatacagcggtcccatagaccttcctatgaagacagagtt
tgttttgtagccacaattagattagctacacctcagtttattaaggaaatgagcactgtt
gaagaacccaatgaagagttcacctctagacatagcttagaatggaagttccttttcttg
gatcacagggcgccaccaataataggttatttgccatttgaagtgttggggacttcaggc
tatgattattatcatgtggatgacctagaaaatctggcaaaatgtcatgaacatttaatg
cagtatgggaaaggaaagtcctgctattacagattcctcacaaaggggcaacagtggatt
tggttgcagacacattattatatcacttaccatcagtggaattctagaccagagttcatc
gtatgtacacacacagttgtaagttatgcagaagttcgagcagaaagacggcgtgaactt
ggaattgaagaggctctgccagagatagcagcagataaaagtcaggactctggttctgac
aatcatataaatacggtgagcctcaaagaagcattggagagatttgatcgcagtccgaca
ccttctgcctcctccaggagttcaaggaaatcttctcacactgcagtctcagacccttca
tcaacaccgacaaagatcacagtggatactagcactcctccacagcaaaatttatccaat
cacgagaagtctgcacaaagaagggcatcacttggtaatcagtctataaattcacaacct
attggacagccattagcacagccaatgatgcctcagcctgcaactttgcagattcagcaa
ggaatgtctcagccaatgcttcagttttcagctcaactaggagctatgcaacacttaaag
gaccaactggaacaaagaacacggatgatagaagcaaacattcatcgccaacaggaagag
ttgcgtaagattcaggaacaactccaaatggtccatggtcaaggcctccagatgttcttg
ccgcagccaactcctggattaaactttggttctgtgcagctgacctctggaaacccatca
aatattcaacagattacaccaataaacatgcaaggtcaagttgttcaaactaatcagatc
caaggtggcctaaacactgggcatattggtagtcagcacatgattcaacaacagcctctt
cagaatactgctgcacagcatagtcaacaagccattctcagtgggcacagccaacagact
tctcttgctactcaatctcagaacgcgctatcaaccccattgtataatactatggtgatt
tcccagccagctccaagcaacgtagtccagattccttcgactttacaacagactaataac
cagaatactgctattactacatttggccaagatagacaaatcagattttctcaaggtcag
cagcttgtaacaaaattagtcactgcccctgtagcttgtggagcagtaatggtaccaagt
actatgtttatgggtcaggtggtgactgcctatcccactttcgctgctcagcaacagcag
caacagccacagacattatcaataacacagcagcagcaaagccagcaggagcagcagcag
caacaacagcagcagcagcagcagcagcagcaacaacaacagcaacaacagcagcagcag
cagcagcagcagcaacaacaacaacaacaacagcagcagcaacaacaacaacagcaacaa
caacagcaacaacttactgttcagcaaccagctcagacacagttgggtcagcatccacaa
caattcttgcagacatccaggttgcttcatgggaatcagtcgactcagcttattctttct
gctgcttttcctctacaacaaagcacttttacacagtcacaccaccagcaacatcagtca
cagcagcaacaacagcagcagcagcagatttcaaggcacagaagtgacagcatgagtgag
gcttccaaagtccaaccacagtag

DBGET integrated database retrieval system