KEGG   Anolis carolinensis (green anole): 100552330Help
Entry
100552330         CDS       T01608                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:acs05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 916 aa AA seqDB search
MEYDAIAHARQRSGKHKEGFAVALVAVCPSRKWRMRSTASPISAVVAAAAVLPVNSRVAH
ARCTRSTHKMSSIADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTPLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPPIYEYVKCIGNFKSLSNMPNSAHNGYEETIQRS
HRPSYEDRVCFVATIRLATPQFIKEMSTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEEALPEIAADKSQDSGSDNHINTVSLKEA
LERFDRSPTPSASSRSSRKSSHTAVSDPSSTPTKITVDTSTPPQQNLSNHEKSAQRRASL
GNQSINSQPIGQPLAQPMMPQPATLQIQQGMSQPMLQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQMVHGQGLQMFLPQPTPGLNFGSVQLTSGNPSNIQQITPINMQ
GQVVQTNQIQGGLNTGHIGSQHMIQQQPLQNTAAQHSQQAILSGHSQQTSLATQSQNALS
TPLYNTMVISQPAPSNVVQIPSTLQQTNNQNTAITTFGQDRQIRFSQGQQLVTKLVTAPV
ACGAVMVPSTMFMGQVVTAYPTFAAQQQQQQPQTLSITQQQQQQQQQQQQQQQLTVQQPA
QTQLGQHPQQFLQTSRLLHGNQSTQLILSAAFPLQQSTFTQSHHQQHQSQQQQQQQQQIS
RHRSDSMSEASKVQPQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgacgccattgcgcatgctcgtcagcggtcagggaaacacaaggagggcttc
gccgtcgccctcgttgcggtttgtccctcaaggaagtggcgcatgcgcagtacagcttct
ccgatctcggcggtggttgctgccgctgctgttttgccggtaaactcgagggtggcgcat
gcgcggtgcacccgaagtacccataaaatgagctccattgcagacagggatgatggtagc
atttttgatggtctcgtggaagaagatgacaaggacaaagcaaagagagtatcaagaaac
aagtctgaaaagaaacgcagagatcaatttaatgtactcatcaaagagctgggatccatg
cttccgggcaatgctcggaagatggacaagtctactgtactgcaaaagagcattgacttt
ttacggaagcacaaagaaatcactgcccagtcagatgctagtgaaatccgacaagactgg
aaacccacattccttagtaatgaagagttcacccagttaatgttagaggctcttgatggt
ttctttctagcaattatgacagatggaagtataatatatgtatcagaaagtgtaaccccc
ttacttgaacatttgccttctgaccttgtggatcagagcatatttaattttgtcccagag
ggggaacattcagaagtttataaaatactgtctactcatctgttagaaagtgattcattg
actccagaatatttgaaatcaaaaaatcagcttgagttctgttgccatatgctccgaggg
acaatagaccccaaagagccacctatatatgaatatgtcaaatgtataggaaacttcaaa
tccttaagtaacatgcctaactctgcacataatggttatgaagaaactatacagcggtcc
catagaccttcctatgaagacagagtttgttttgtagccacaattagattagctacacct
cagtttattaaggaaatgagcactgttgaagaacccaatgaagagttcacctctagacat
agcttagaatggaagttccttttcttggatcacagggcgccaccaataataggttatttg
ccatttgaagtgttggggacttcaggctatgattattatcatgtggatgacctagaaaat
ctggcaaaatgtcatgaacatttaatgcagtatgggaaaggaaagtcctgctattacaga
ttcctcacaaaggggcaacagtggatttggttgcagacacattattatatcacttaccat
cagtggaattctagaccagagttcatcgtatgtacacacacagttgtaagttatgcagaa
gttcgagcagaaagacggcgtgaacttggaattgaagaggctctgccagagatagcagca
gataaaagtcaggactctggttctgacaatcatataaatacggtgagcctcaaagaagca
ttggagagatttgatcgcagtccgacaccttctgcctcctccaggagttcaaggaaatct
tctcacactgcagtctcagacccttcatcaacaccgacaaagatcacagtggatactagc
actcctccacagcaaaatttatccaatcacgagaagtctgcacaaagaagggcatcactt
ggtaatcagtctataaattcacaacctattggacagccattagcacagccaatgatgcct
cagcctgcaactttgcagattcagcaaggaatgtctcagccaatgcttcagttttcagct
caactaggagctatgcaacacttaaaggaccaactggaacaaagaacacggatgatagaa
gcaaacattcatcgccaacaggaagagttgcgtaagattcaggaacaactccaaatggtc
catggtcaaggcctccagatgttcttgccgcagccaactcctggattaaactttggttct
gtgcagctgacctctggaaacccatcaaatattcaacagattacaccaataaacatgcaa
ggtcaagttgttcaaactaatcagatccaaggtggcctaaacactgggcatattggtagt
cagcacatgattcaacaacagcctcttcagaatactgctgcacagcatagtcaacaagcc
attctcagtgggcacagccaacagacttctcttgctactcaatctcagaacgcgctatca
accccattgtataatactatggtgatttcccagccagctccaagcaacgtagtccagatt
ccttcgactttacaacagactaataaccagaatactgctattactacatttggccaagat
agacaaatcagattttctcaaggtcagcagcttgtaacaaaattagtcactgcccctgta
gcttgtggagcagtaatggtaccaagtactatgtttatgggtcaggtggtgactgcctat
cccactttcgctgctcagcaacagcagcaacagccacagacattatcaataacacaacag
cagcagcaacaacaacaacagcaacaacaacagcaacaacttactgttcagcaaccagct
cagacacagttgggtcagcatccacaacaattcttgcagacatccaggttgcttcatggg
aatcagtcgactcagcttattctttctgctgcttttcctctacaacaaagcacttttaca
cagtcacaccaccagcaacatcagtcacagcagcaacaacagcagcagcagcagatttca
aggcacagaagtgacagcatgagtgaggcttccaaagtccaaccacagtag

DBGET integrated database retrieval system