KEGG   Anolis carolinensis (green anole): 100552364Help
Entry
100552364         CDS       T01608                                 

Gene name
dlat
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100552364 (dlat)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100552364 (dlat)
   00020 Citrate cycle (TCA cycle)
    100552364 (dlat)
   00620 Pyruvate metabolism
    100552364 (dlat)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100552364 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 638 aa AA seqDB search
MWRALARRVARQCAAPRRAGAGASAGARPRGRAFAHHKAAAAAASSPAFPPPPWGPRAPL
LLPQTGAGKAGPQAAPARPWSSHPPHQKVPLPALSPTMQMGTIARWEKKEGDKISEGDLI
AEVETDKATVGFESLEECYLAKILVPEGTRDVPIGAIICITVDKPELVDAFKNYTLDAAA
TAPPASVPPPPPPSAAAPSAPASQPSARAPGSSYPPHMQIALPALSPTMTMGTVQRWEKK
LGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVEEGTRDVPLGTPLCIIVERESDIA
AFADYKDAGVAEIKPPPPPASPAPVCAVAPPLPQPAAKGPVHKGRVVASPLAKKLAAEKG
IDLSQVKGTGPDGRITKKDIESFVPSKVAPARAAEPTPMAVPAAIPAAAAPPGVFTDIPI
SNIRKVIAQRLMQSKQTIPHYYLSIDVNMGDILVLRKELNQNTKLSVNDFIIKASALACM
KVPEANSSWLDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHAKGLASINQDVVTLAARAR
EGKLKPHEFQGGTFTVSNLGMYGIKNFSAIINPPQACILAVGGSEQRLVPADNEKGFATS
SVMSVTLSCDHRVVDGAVGAQWLAEFKKFLEKPSTMLL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggcgctggcgaggcgcgtggcccggcagtgcgcggcccccaggcgggccggg
gcgggggcgagcgcgggggccaggccgcgggggcgcgccttcgcccaccacaaggccgcc
gccgccgccgcttcctcccccgccttcccgccccctccgtggggcccgagggcgccgctg
ctgctgcctcagacgggagccgggaaagccgggcctcaggccgcccccgcccggccctgg
agcagccacccgccccaccagaaggtgcctttgcccgctctctcgcccacgatgcagatg
gggaccattgctcggtgggagaagaaggaaggcgacaagatcagcgaaggggacctcatc
gcagaggtggagacagacaaagcaaccgtagggttcgagagcctcgaagaatgttacctg
gctaagatcctggtgccggaaggtacgcgggacgtccccataggagccatcatatgcatc
actgtagacaagcctgagcttgtcgatgcctttaagaattacactttggatgctgcagcc
actgctcctccagcctcagtgcctcctccacctcctccttcagcggcagcgccatccgca
cccgcatctcaaccctccgctcgggctccagggagctcctaccctccccacatgcagatt
gctctccctgccctttccccgacaatgacgatgggcaccgttcagagatgggaaaagaaa
ttgggtgaaaagctgagcgaaggagacctcttggcagaaatcgagacggacaaagcgacg
ataggctttgaagtacaagaagaaggctatttggcgaaaatcctagtggaagaaggcaca
agggatgtgcctttgggaaccccgttgtgcatcatcgtggagagggagtcggacatcgct
gcctttgcagactacaaagatgccggagtggccgagatcaaacctccaccgccacccgct
tcgcccgctcctgtatgtgcagttgctcctccgctgccgcagcctgcagccaagggacct
gtgcataaagggagagtggtagccagccccttggcaaagaaactggccgcagagaaggga
attgatctttcgcaggtgaaaggtacgggaccagatggaaggataactaagaaggacatc
gagtcatttgtgccatcaaaggtagccccggcccgggcagcagagcccactcctatggca
gtgccagcagcaataccggctgcagccgccccgccaggagtttttacagatattcccatc
agcaatattcgcaaggtcattgcccagcgtctgatgcaatccaagcaaacgatacctcac
tattacctctccatcgatgtcaacatgggagatatattggtgctaagaaaagaactcaac
cagaacacgaagctctccgtcaacgacttcatcatcaaggcttcggccctggcgtgcatg
aaggtgccagaggccaactcctcctggctggacaccgtcattcggcagaaccacgttgtt
gacgtcagcgtcgcggtcagcaccccggccggacttatcacccccattgtatttaatgcg
cacgccaagggcctggcttccatcaaccaagatgtcgtgacattggcagccagggctcgg
gaaggcaagctcaagccccacgaatttcagggaggaactttcacggtctcaaacttagga
atgtacggcattaagaacttctccgccatcatcaacccgccccaggcttgcattttggcc
gtggggggctctgagcagaggctggtcccagcagacaatgaaaaggggtttgccacgtcc
agcgtgatgtcggtgacgctgagctgcgaccaccgtgtggtggacggagcggtgggcgcc
cagtggctggccgagttcaagaagttcctggagaagccctccaccatgctgctataa

DBGET integrated database retrieval system